Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 3148966..3149995 | Replicon | chromosome |
| Accession | NZ_CP119869 | ||
| Organism | Methylosinus trichosporium OB3b | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | P3C36_RS15125 | Protein ID | WP_244441355.1 |
| Coordinates | 3149555..3149995 (+) | Length | 147 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | A0A1A6FRX6 |
| Locus tag | P3C36_RS15120 | Protein ID | WP_003614574.1 |
| Coordinates | 3148966..3149430 (+) | Length | 155 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3C36_RS15105 | 3145742..3147538 | - | 1797 | WP_003614570.1 | DNA helicase RecQ | - |
| P3C36_RS15110 | 3147584..3147862 | - | 279 | WP_003614571.1 | hypothetical protein | - |
| P3C36_RS15115 | 3147912..3148754 | - | 843 | WP_003614572.1 | hypothetical protein | - |
| P3C36_RS15120 | 3148966..3149430 | + | 465 | WP_003614574.1 | helix-turn-helix domain-containing protein | Antitoxin |
| P3C36_RS15125 | 3149555..3149995 | + | 441 | WP_244441355.1 | PIN domain-containing protein | Toxin |
| P3C36_RS15130 | 3150228..3150587 | - | 360 | WP_003614858.1 | response regulator | - |
| P3C36_RS15135 | 3150677..3151186 | - | 510 | WP_283472100.1 | HWE histidine kinase domain-containing protein | - |
| P3C36_RS15140 | 3151161..3152774 | - | 1614 | WP_283470244.1 | PAS domain-containing protein | - |
| P3C36_RS15145 | 3152910..3153950 | + | 1041 | WP_003614863.1 | signal recognition particle-docking protein FtsY | - |
| P3C36_RS15150 | 3153947..3154564 | + | 618 | WP_003614865.1 | septation protein A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16385.79 Da Isoelectric Point: 5.1962
>T274481 WP_244441355.1 NZ_CP119869:3149555-3149995 [Methylosinus trichosporium OB3b]
IEALLRNEPHRDRSLLERTRDRMDQHVRDYLVTGYEPLIPSLVLPDMNDRHVLAAAIVGRCDVIVTQNLKHFPETALAPL
DIDAQHPDEFLCNQLDLAPGIFCAAVRKVCARLKNPLYSVDDYLANLTRQGLVGAASELEQFSGLI
IEALLRNEPHRDRSLLERTRDRMDQHVRDYLVTGYEPLIPSLVLPDMNDRHVLAAAIVGRCDVIVTQNLKHFPETALAPL
DIDAQHPDEFLCNQLDLAPGIFCAAVRKVCARLKNPLYSVDDYLANLTRQGLVGAASELEQFSGLI
Download Length: 441 bp
Antitoxin
Download Length: 155 a.a. Molecular weight: 17117.60 Da Isoelectric Point: 7.4709
>AT274481 WP_003614574.1 NZ_CP119869:3148966-3149430 [Methylosinus trichosporium OB3b]
MTALAHRQLPPTAQDAAIARTSGQRLSRFARSNRSLSLRITDAEQEQPIELPAGAVSLLMDILEAMAAGRGVTLIPENAE
LTSVQAADILNVSRPFLIGLLDSKAIPHHKVGKHRRIRMEDVMAYKERIDRERETVLDQLVADAQEHDMGYSRK
MTALAHRQLPPTAQDAAIARTSGQRLSRFARSNRSLSLRITDAEQEQPIELPAGAVSLLMDILEAMAAGRGVTLIPENAE
LTSVQAADILNVSRPFLIGLLDSKAIPHHKVGKHRRIRMEDVMAYKERIDRERETVLDQLVADAQEHDMGYSRK
Download Length: 465 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|