Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 307471..308354 | Replicon | chromosome |
Accession | NZ_CP119869 | ||
Organism | Methylosinus trichosporium OB3b |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | P3C36_RS01420 | Protein ID | WP_283471160.1 |
Coordinates | 307743..308354 (+) | Length | 204 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A1A6FQL2 |
Locus tag | P3C36_RS01415 | Protein ID | WP_003608948.1 |
Coordinates | 307471..307746 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3C36_RS01390 | 303212..304198 | - | 987 | WP_003608940.1 | ferrochelatase | - |
P3C36_RS01395 | 304195..305007 | - | 813 | WP_003608942.1 | 3-methyl-2-oxobutanoate hydroxymethyltransferase | - |
P3C36_RS01400 | 305042..305167 | - | 126 | WP_274541221.1 | hypothetical protein | - |
P3C36_RS01405 | 305365..305937 | - | 573 | WP_003608944.1 | L,D-transpeptidase | - |
P3C36_RS01410 | 306095..307318 | + | 1224 | WP_003608946.1 | alpha/beta hydrolase | - |
P3C36_RS01415 | 307471..307746 | + | 276 | WP_003608948.1 | DUF1778 domain-containing protein | Antitoxin |
P3C36_RS01420 | 307743..308354 | + | 612 | WP_283471160.1 | GNAT family N-acetyltransferase | Toxin |
P3C36_RS01425 | 308971..309456 | - | 486 | WP_155931266.1 | hypothetical protein | - |
P3C36_RS01430 | 309973..310950 | + | 978 | WP_003608953.1 | methenyltetrahydromethanopterin cyclohydrolase | - |
P3C36_RS01435 | 310904..311869 | + | 966 | WP_283471163.1 | RimK family alpha-L-glutamate ligase | - |
P3C36_RS01440 | 311862..312725 | + | 864 | WP_003608957.1 | triphosphoribosyl-dephospho-CoA synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 142155..342228 | 200073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 204 a.a. Molecular weight: 22388.85 Da Isoelectric Point: 10.2082
>T274476 WP_283471160.1 NZ_CP119869:307743-308354 [Methylosinus trichosporium OB3b]
MTALEWEEVSLGKIHDRNAFHCGEDHLDTYLKRYARQNHESGGAKCFVAAARDAPTRVLGFYTLSPASIEFARAPAVATR
GLGRYEVPVYRLGRLAVDRSVQGRGLGGRLLLRAAERCMAVAQQVGGVALLIDAKTEMVAEWVRKLRGTTSPRCAALAHP
ALRRGGRSGEARGAMMLSNVTYARRMRPFFLIQVEVDYSEVLI
MTALEWEEVSLGKIHDRNAFHCGEDHLDTYLKRYARQNHESGGAKCFVAAARDAPTRVLGFYTLSPASIEFARAPAVATR
GLGRYEVPVYRLGRLAVDRSVQGRGLGGRLLLRAAERCMAVAQQVGGVALLIDAKTEMVAEWVRKLRGTTSPRCAALAHP
ALRRGGRSGEARGAMMLSNVTYARRMRPFFLIQVEVDYSEVLI
Download Length: 612 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|