Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF-MazE |
Location | 931104..931729 | Replicon | chromosome |
Accession | NZ_CP119863 | ||
Organism | Agrobacterium fabrum strain NT1RE |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q7D0B1 |
Locus tag | NT1RE_RS04665 | Protein ID | WP_006311244.1 |
Coordinates | 931370..931729 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q7D0B2 |
Locus tag | NT1RE_RS04660 | Protein ID | WP_010971270.1 |
Coordinates | 931104..931370 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NT1RE_RS04630 (NT1RE_04630) | 926278..926613 | - | 336 | WP_010971265.1 | type II toxin-antitoxin system YafQ family toxin | - |
NT1RE_RS04635 (NT1RE_04635) | 926610..926885 | - | 276 | WP_010971266.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
NT1RE_RS04640 (NT1RE_04640) | 926993..927601 | + | 609 | WP_010971267.1 | class I SAM-dependent methyltransferase | - |
NT1RE_RS04645 (NT1RE_04645) | 927777..930362 | + | 2586 | WP_035256421.1 | heavy metal translocating P-type ATPase | - |
NT1RE_RS04650 (NT1RE_04650) | 930359..930781 | + | 423 | WP_006311241.1 | Cu(I)-responsive transcriptional regulator | - |
NT1RE_RS04655 (NT1RE_04655) | 930834..931034 | + | 201 | WP_006311242.1 | heavy-metal-associated domain-containing protein | - |
NT1RE_RS04660 (NT1RE_04660) | 931104..931370 | + | 267 | WP_010971270.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NT1RE_RS04665 (NT1RE_04665) | 931370..931729 | + | 360 | WP_006311244.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NT1RE_RS04670 (NT1RE_04670) | 931737..931985 | - | 249 | WP_006311245.1 | hypothetical protein | - |
NT1RE_RS04675 (NT1RE_04675) | 932164..933552 | + | 1389 | WP_169539085.1 | MFS transporter | - |
NT1RE_RS04680 (NT1RE_04680) | 933631..933804 | - | 174 | WP_010971273.1 | hypothetical protein | - |
NT1RE_RS04685 (NT1RE_04685) | 933873..935591 | - | 1719 | WP_035256424.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12857.04 Da Isoelectric Point: 8.2782
>T274474 WP_006311244.1 NZ_CP119863:931370-931729 [Agrobacterium fabrum]
MVRNQIPKRGDVYLVDLNPVVGSEIKDEHRCVVITPREINAVGLCLVVPVTTGGMFTRKAGLAVNISGHKTTGVALCNQV
RSMDIVARVAQKKAKYIETLDDATIDEIAGRVISMIDPA
MVRNQIPKRGDVYLVDLNPVVGSEIKDEHRCVVITPREINAVGLCLVVPVTTGGMFTRKAGLAVNISGHKTTGVALCNQV
RSMDIVARVAQKKAKYIETLDDATIDEIAGRVISMIDPA
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|