Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 926278..926885 | Replicon | chromosome |
| Accession | NZ_CP119863 | ||
| Organism | Agrobacterium fabrum strain NT1RE | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q7D0B7 |
| Locus tag | NT1RE_RS04630 | Protein ID | WP_010971265.1 |
| Coordinates | 926278..926613 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A9CJP8 |
| Locus tag | NT1RE_RS04635 | Protein ID | WP_010971266.1 |
| Coordinates | 926610..926885 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NT1RE_RS04615 (NT1RE_04615) | 922383..924578 | - | 2196 | WP_035256415.1 | transglycosylase domain-containing protein | - |
| NT1RE_RS04620 (NT1RE_04620) | 924835..925314 | + | 480 | WP_010971263.1 | YcgN family cysteine cluster protein | - |
| NT1RE_RS04625 (NT1RE_04625) | 925426..926250 | + | 825 | WP_010971264.1 | class D beta-lactamase | - |
| NT1RE_RS04630 (NT1RE_04630) | 926278..926613 | - | 336 | WP_010971265.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NT1RE_RS04635 (NT1RE_04635) | 926610..926885 | - | 276 | WP_010971266.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NT1RE_RS04640 (NT1RE_04640) | 926993..927601 | + | 609 | WP_010971267.1 | class I SAM-dependent methyltransferase | - |
| NT1RE_RS04645 (NT1RE_04645) | 927777..930362 | + | 2586 | WP_035256421.1 | heavy metal translocating P-type ATPase | - |
| NT1RE_RS04650 (NT1RE_04650) | 930359..930781 | + | 423 | WP_006311241.1 | Cu(I)-responsive transcriptional regulator | - |
| NT1RE_RS04655 (NT1RE_04655) | 930834..931034 | + | 201 | WP_006311242.1 | heavy-metal-associated domain-containing protein | - |
| NT1RE_RS04660 (NT1RE_04660) | 931104..931370 | + | 267 | WP_010971270.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| NT1RE_RS04665 (NT1RE_04665) | 931370..931729 | + | 360 | WP_006311244.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12991.86 Da Isoelectric Point: 10.0059
>T274473 WP_010971265.1 NZ_CP119863:c926613-926278 [Agrobacterium fabrum]
VTNKKDHGKDAALKRATLPRRSDFTKQFIKDWQRLNNSGRYDMVRLKEIMLLLIANGAPLPTQFRDHELTGDWRDHRECH
VGGDFLLIYTVDEKQNLLIFTRAGTHAELFR
VTNKKDHGKDAALKRATLPRRSDFTKQFIKDWQRLNNSGRYDMVRLKEIMLLLIANGAPLPTQFRDHELTGDWRDHRECH
VGGDFLLIYTVDEKQNLLIFTRAGTHAELFR
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|