Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4738898..4739514 | Replicon | chromosome |
| Accession | NZ_CP119862 | ||
| Organism | Citrobacter sp. S171 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P2W74_RS22550 | Protein ID | WP_276293314.1 |
| Coordinates | 4738898..4739272 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P2W74_RS22555 | Protein ID | WP_192614423.1 |
| Coordinates | 4739272..4739514 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2W74_RS22535 (4736398) | 4736398..4737300 | + | 903 | WP_276293312.1 | formate dehydrogenase subunit beta | - |
| P2W74_RS22540 (4737297) | 4737297..4737932 | + | 636 | WP_192613906.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P2W74_RS22545 (4737929) | 4737929..4738858 | + | 930 | WP_276293313.1 | formate dehydrogenase accessory protein FdhE | - |
| P2W74_RS22550 (4738898) | 4738898..4739272 | - | 375 | WP_276293314.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P2W74_RS22555 (4739272) | 4739272..4739514 | - | 243 | WP_192614423.1 | CopG family transcriptional regulator | Antitoxin |
| P2W74_RS22560 (4739720) | 4739720..4740628 | + | 909 | WP_276293315.1 | alpha/beta hydrolase | - |
| P2W74_RS22565 (4740810) | 4740810..4741751 | - | 942 | WP_203359406.1 | fatty acid biosynthesis protein FabY | - |
| P2W74_RS22570 (4741796) | 4741796..4742233 | - | 438 | WP_276293316.1 | D-aminoacyl-tRNA deacylase | - |
| P2W74_RS22575 (4742230) | 4742230..4743102 | - | 873 | WP_276293317.1 | virulence factor BrkB family protein | - |
| P2W74_RS22580 (4743096) | 4743096..4743695 | - | 600 | WP_203359408.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13735.88 Da Isoelectric Point: 7.2022
>T274471 WP_276293314.1 NZ_CP119862:c4739272-4738898 [Citrobacter sp. S171]
MAKGSALFDTNILIDLFSGRGEAKQALDAWPPQNAISLITWMEVLVGARKYNQEHRTRVAMSAFNIIGVSQEIAERSVVL
RQDYGLKLPDAIILATAQIHRLELVTRNTKDFAGIPGVVTPYEL
MAKGSALFDTNILIDLFSGRGEAKQALDAWPPQNAISLITWMEVLVGARKYNQEHRTRVAMSAFNIIGVSQEIAERSVVL
RQDYGLKLPDAIILATAQIHRLELVTRNTKDFAGIPGVVTPYEL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|