Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3576502..3577122 Replicon chromosome
Accession NZ_CP119862
Organism Citrobacter sp. S171

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P2W74_RS17140 Protein ID WP_002892050.1
Coordinates 3576904..3577122 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A8AJY4
Locus tag P2W74_RS17135 Protein ID WP_012133514.1
Coordinates 3576502..3576876 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2W74_RS17125 (3571635) 3571635..3572828 + 1194 WP_276292556.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P2W74_RS17130 (3572851) 3572851..3576000 + 3150 WP_276292557.1 efflux RND transporter permease AcrB -
P2W74_RS17135 (3576502) 3576502..3576876 + 375 WP_012133514.1 Hha toxicity modulator TomB Antitoxin
P2W74_RS17140 (3576904) 3576904..3577122 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P2W74_RS17145 (3577306) 3577306..3577857 + 552 WP_276292558.1 maltose O-acetyltransferase -
P2W74_RS17150 (3577972) 3577972..3578442 + 471 WP_276292559.1 YlaC family protein -
P2W74_RS17155 (3578515) 3578515..3578655 - 141 WP_192611404.1 type B 50S ribosomal protein L36 -
P2W74_RS17160 (3578657) 3578657..3578917 - 261 WP_203358647.1 type B 50S ribosomal protein L31 -
P2W74_RS17165 (3579132) 3579132..3580682 + 1551 WP_276292560.1 EAL domain-containing protein -
P2W74_RS17170 (3580722) 3580722..3581075 - 354 WP_192611401.1 DUF1428 family protein -
P2W74_RS17175 (3581141) 3581141..3581770 - 630 WP_276292561.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T274470 WP_002892050.1 NZ_CP119862:3576904-3577122 [Citrobacter sp. S171]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14437.27 Da        Isoelectric Point: 5.1444

>AT274470 WP_012133514.1 NZ_CP119862:3576502-3576876 [Citrobacter sp. S171]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNATRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A8AJY4

References