Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2426002..2426642 | Replicon | chromosome |
| Accession | NZ_CP119862 | ||
| Organism | Citrobacter sp. S171 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | P2W74_RS11845 | Protein ID | WP_276295086.1 |
| Coordinates | 2426002..2426178 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P2W74_RS11850 | Protein ID | WP_276295180.1 |
| Coordinates | 2426226..2426642 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2W74_RS11825 (2422822) | 2422822..2423052 | - | 231 | WP_203361271.1 | DUF2554 family protein | - |
| P2W74_RS11830 (2423199) | 2423199..2423327 | - | 129 | WP_276295083.1 | DUF2474 domain-containing protein | - |
| P2W74_RS11835 (2423327) | 2423327..2424337 | - | 1011 | WP_276295084.1 | cytochrome d ubiquinol oxidase subunit II | - |
| P2W74_RS11840 (2424337) | 2424337..2425740 | - | 1404 | WP_276295085.1 | cytochrome ubiquinol oxidase subunit I | - |
| P2W74_RS11845 (2426002) | 2426002..2426178 | + | 177 | WP_276295086.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P2W74_RS11850 (2426226) | 2426226..2426642 | + | 417 | WP_276295180.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P2W74_RS11855 (2426759) | 2426759..2428168 | + | 1410 | WP_276295087.1 | PLP-dependent aminotransferase family protein | - |
| P2W74_RS11860 (2428506) | 2428506..2429651 | + | 1146 | WP_276295088.1 | ABC transporter substrate-binding protein | - |
| P2W74_RS11865 (2429669) | 2429669..2430682 | + | 1014 | WP_276295089.1 | ABC transporter ATP-binding protein | - |
| P2W74_RS11870 (2430689) | 2430689..2431627 | + | 939 | WP_203361272.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6754.87 Da Isoelectric Point: 11.3242
>T274464 WP_276295086.1 NZ_CP119862:2426002-2426178 [Citrobacter sp. S171]
VKQSELRRWLESQGVEVTNGANHLKLRYHGKRSVMPRHPGDEIKEPLRKAILKQLGLR
VKQSELRRWLESQGVEVTNGANHLKLRYHGKRSVMPRHPGDEIKEPLRKAILKQLGLR
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15211.38 Da Isoelectric Point: 4.2978
>AT274464 WP_276295180.1 NZ_CP119862:2426226-2426642 [Citrobacter sp. S171]
MRYPVNLTPAPEGGYVVSFPDIPEALTQGDTRQESLEAAFDALMTALEFYFEDNEPIPQPSVLCDADAYVDVPLSVTSKI
LLLNAFLESSITQQELATRIGKPKQEITRLFDLRHSTKIDTVQAAAKALGKELKLTLV
MRYPVNLTPAPEGGYVVSFPDIPEALTQGDTRQESLEAAFDALMTALEFYFEDNEPIPQPSVLCDADAYVDVPLSVTSKI
LLLNAFLESSITQQELATRIGKPKQEITRLFDLRHSTKIDTVQAAAKALGKELKLTLV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|