Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1126552..1127209 | Replicon | chromosome |
Accession | NZ_CP119862 | ||
Organism | Citrobacter sp. S171 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | P2W74_RS05415 | Protein ID | WP_276294209.1 |
Coordinates | 1126552..1126872 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | P2W74_RS05420 | Protein ID | WP_276294210.1 |
Coordinates | 1126892..1127209 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2W74_RS05405 (1123451) | 1123451..1124656 | - | 1206 | WP_276294208.1 | DUF4236 domain-containing protein | - |
P2W74_RS05410 (1124841) | 1124841..1126216 | - | 1376 | Protein_1057 | IS3 family transposase | - |
P2W74_RS05415 (1126552) | 1126552..1126872 | - | 321 | WP_276294209.1 | TA system toxin CbtA family protein | Toxin |
P2W74_RS05420 (1126892) | 1126892..1127209 | - | 318 | WP_276294210.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P2W74_RS05425 (1127227) | 1127227..1127448 | - | 222 | WP_276294211.1 | DUF987 domain-containing protein | - |
P2W74_RS05430 (1127457) | 1127457..1127933 | - | 477 | WP_276294212.1 | RadC family protein | - |
P2W74_RS05435 (1127949) | 1127949..1128407 | - | 459 | WP_276294213.1 | antirestriction protein | - |
P2W74_RS05440 (1128508) | 1128508..1128747 | - | 240 | WP_276294214.1 | DUF905 domain-containing protein | - |
P2W74_RS05445 (1128847) | 1128847..1129755 | - | 909 | WP_276294215.1 | Ivy family c-type lysozyme inhibitor | - |
P2W74_RS05450 (1129824) | 1129824..1129991 | - | 168 | Protein_1065 | DUF4339 domain-containing protein | - |
P2W74_RS05455 (1130029) | 1130029..1130724 | - | 696 | WP_276294216.1 | transcriptional regulator | - |
P2W74_RS05460 (1130951) | 1130951..1131778 | - | 828 | WP_276294217.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1123451..1179809 | 56358 | |
- | flank | IS/Tn | - | - | 1124841..1125071 | 230 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12220.16 Da Isoelectric Point: 8.0375
>T274463 WP_276294209.1 NZ_CP119862:c1126872-1126552 [Citrobacter sp. S171]
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDASISLVDAVNFLVEKYELVRIDRKGF
SWQEQSPFITTVDILRARRTMRETRT
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDASISLVDAVNFLVEKYELVRIDRKGF
SWQEQSPFITTVDILRARRTMRETRT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|