Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 807444..808104 | Replicon | chromosome |
| Accession | NZ_CP119862 | ||
| Organism | Citrobacter sp. S171 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | P2W74_RS03965 | Protein ID | WP_276293976.1 |
| Coordinates | 807691..808104 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | P2W74_RS03960 | Protein ID | WP_162380161.1 |
| Coordinates | 807444..807710 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2W74_RS03935 (802645) | 802645..804078 | - | 1434 | WP_276293973.1 | 6-phospho-beta-glucosidase BglA | - |
| P2W74_RS03940 (804199) | 804199..804927 | - | 729 | WP_276295123.1 | MurR/RpiR family transcriptional regulator | - |
| P2W74_RS03945 (804980) | 804980..805291 | + | 312 | WP_276295124.1 | N(4)-acetylcytidine aminohydrolase | - |
| P2W74_RS03950 (805454) | 805454..806113 | + | 660 | WP_276293974.1 | hemolysin III family protein | - |
| P2W74_RS03955 (806207) | 806207..807187 | - | 981 | WP_276293975.1 | tRNA-modifying protein YgfZ | - |
| P2W74_RS03960 (807444) | 807444..807710 | + | 267 | WP_162380161.1 | FAD assembly factor SdhE | Antitoxin |
| P2W74_RS03965 (807691) | 807691..808104 | + | 414 | WP_276293976.1 | protein YgfX | Toxin |
| P2W74_RS03970 (808172) | 808172..808693 | - | 522 | WP_276293977.1 | flavodoxin FldB | - |
| P2W74_RS03975 (808806) | 808806..809702 | + | 897 | WP_276293978.1 | site-specific tyrosine recombinase XerD | - |
| P2W74_RS03980 (809726) | 809726..810439 | + | 714 | WP_276293979.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P2W74_RS03985 (810445) | 810445..812178 | + | 1734 | WP_276293980.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16389.43 Da Isoelectric Point: 11.0586
>T274462 WP_276293976.1 NZ_CP119862:807691-808104 [Citrobacter sp. S171]
VVLWQSDLRVSWRAQWLSLLLHGLVAALILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGL
EWAILSAPWMLKTGMMMRLRSDSGRRQHLWLAADSMDEKEWRELRRVMLQQTEQEKH
VVLWQSDLRVSWRAQWLSLLLHGLVAALILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINTRQGEIKLLMDGRLRWQGL
EWAILSAPWMLKTGMMMRLRSDSGRRQHLWLAADSMDEKEWRELRRVMLQQTEQEKH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|