Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4469322..4469917 | Replicon | chromosome |
| Accession | NZ_CP119773 | ||
| Organism | Dickeya fangzhongdai strain ZXC1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | PQ617_RS19805 | Protein ID | WP_038658062.1 |
| Coordinates | 4469322..4469699 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | PQ617_RS19810 | Protein ID | WP_039692075.1 |
| Coordinates | 4469696..4469917 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ617_RS19785 (PQ617_19785) | 4465425..4465655 | + | 231 | WP_107759568.1 | tautomerase PptA | - |
| PQ617_RS19790 (PQ617_19790) | 4466154..4467131 | + | 978 | WP_049854088.1 | DUF1852 domain-containing protein | - |
| PQ617_RS19795 (PQ617_19795) | 4467159..4468190 | + | 1032 | WP_276217993.1 | methionine synthase | - |
| PQ617_RS19800 (PQ617_19800) | 4468378..4469025 | - | 648 | WP_276217995.1 | EcsC family protein | - |
| PQ617_RS19805 (PQ617_19805) | 4469322..4469699 | - | 378 | WP_038658062.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PQ617_RS19810 (PQ617_19810) | 4469696..4469917 | - | 222 | WP_039692075.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQ617_RS19815 (PQ617_19815) | 4470054..4471202 | - | 1149 | WP_276217997.1 | L-threonine dehydrogenase | - |
| PQ617_RS19820 (PQ617_19820) | 4471589..4472044 | + | 456 | WP_238556038.1 | NUDIX domain-containing protein | - |
| PQ617_RS19830 (PQ617_19830) | 4472889..4473566 | - | 678 | WP_038658056.1 | respiratory nitrate reductase subunit gamma | - |
| PQ617_RS19835 (PQ617_19835) | 4473566..4474285 | - | 720 | WP_276217999.1 | nitrate reductase molybdenum cofactor assembly chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14194.26 Da Isoelectric Point: 5.1873
>T274460 WP_038658062.1 NZ_CP119773:c4469699-4469322 [Dickeya fangzhongdai]
MKWVSAQDVIAFHDRILQVLPGVAGMADPGRAEALIYRVQNRLYYEDMTDLFELAATYWVTVARGHIFNDGNKRTAFFVT
MVFLRRNGVLIADNDNSLEELTVKAATGECQVSELAEQLRLRVEK
MKWVSAQDVIAFHDRILQVLPGVAGMADPGRAEALIYRVQNRLYYEDMTDLFELAATYWVTVARGHIFNDGNKRTAFFVT
MVFLRRNGVLIADNDNSLEELTVKAATGECQVSELAEQLRLRVEK
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|