Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 3308067..3308620 | Replicon | chromosome |
| Accession | NZ_CP119773 | ||
| Organism | Dickeya fangzhongdai strain ZXC1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | PQ617_RS14685 | Protein ID | WP_276196150.1 |
| Coordinates | 3308306..3308620 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | PQ617_RS14680 | Protein ID | WP_110372302.1 |
| Coordinates | 3308067..3308303 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ617_RS14665 (PQ617_14665) | 3303612..3304847 | - | 1236 | WP_276196149.1 | DNA cytosine methyltransferase | - |
| PQ617_RS14670 (PQ617_14670) | 3305128..3306150 | + | 1023 | WP_210182511.1 | DUF4917 family protein | - |
| PQ617_RS14675 (PQ617_14675) | 3306802..3307743 | + | 942 | Protein_2846 | zincin-like metallopeptidase domain-containing protein | - |
| PQ617_RS14680 (PQ617_14680) | 3308067..3308303 | + | 237 | WP_110372302.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PQ617_RS14685 (PQ617_14685) | 3308306..3308620 | + | 315 | WP_276196150.1 | CcdB family protein | Toxin |
| PQ617_RS14690 (PQ617_14690) | 3308623..3309372 | + | 750 | WP_276196151.1 | hypothetical protein | - |
| PQ617_RS14695 (PQ617_14695) | 3309586..3310437 | - | 852 | WP_276196153.1 | hypothetical protein | - |
| PQ617_RS14700 (PQ617_14700) | 3310431..3312185 | - | 1755 | WP_276196154.1 | ATP-binding protein | - |
| PQ617_RS14705 (PQ617_14705) | 3312656..3313393 | + | 738 | WP_276196155.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3284322..3315999 | 31677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11519.49 Da Isoelectric Point: 6.9727
>T274454 WP_276196150.1 NZ_CP119773:3308306-3308620 [Dickeya fangzhongdai]
MQFTVYGNTGKSTVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVMLTDGKEYAVMTHELASIPVQVLG
AVFCDASQYRNQVKAAIDFLIDGI
MQFTVYGNTGKSTVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVMLTDGKEYAVMTHELASIPVQVLG
AVFCDASQYRNQVKAAIDFLIDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|