Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 2897138..2897966 | Replicon | chromosome |
| Accession | NZ_CP119773 | ||
| Organism | Dickeya fangzhongdai strain ZXC1 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | A0A3A4CQM7 |
| Locus tag | PQ617_RS12945 | Protein ID | WP_024105035.1 |
| Coordinates | 2897138..2897674 (-) | Length | 179 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | - |
| Locus tag | PQ617_RS12950 | Protein ID | WP_050569822.1 |
| Coordinates | 2897655..2897966 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ617_RS12925 (PQ617_12925) | 2892542..2893510 | + | 969 | WP_276195893.1 | o-succinylbenzoate synthase | - |
| PQ617_RS12930 (PQ617_12930) | 2893498..2894877 | + | 1380 | WP_100849132.1 | o-succinylbenzoate--CoA ligase | - |
| PQ617_RS12935 (PQ617_12935) | 2895084..2895629 | + | 546 | WP_276195895.1 | YfaZ family outer membrane protein | - |
| PQ617_RS12940 (PQ617_12940) | 2895783..2896976 | + | 1194 | WP_276195897.1 | nicotinamide mononucleotide deamidase-related protein YfaY | - |
| PQ617_RS12945 (PQ617_12945) | 2897138..2897674 | - | 537 | WP_024105035.1 | GNAT family N-acetyltransferase | Toxin |
| PQ617_RS12950 (PQ617_12950) | 2897655..2897966 | - | 312 | WP_050569822.1 | DUF1778 domain-containing protein | Antitoxin |
| PQ617_RS12955 (PQ617_12955) | 2898265..2898545 | - | 281 | Protein_2512 | IS4 family transposase | - |
| PQ617_RS12960 (PQ617_12960) | 2898648..2899508 | - | 861 | WP_100849133.1 | co-chaperone YbbN | - |
| PQ617_RS12965 (PQ617_12965) | 2899571..2900347 | - | 777 | WP_038661068.1 | SDR family oxidoreductase | - |
| PQ617_RS12970 (PQ617_12970) | 2900411..2901052 | - | 642 | WP_050570000.1 | multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 | - |
| PQ617_RS12975 (PQ617_12975) | 2901020..2901706 | + | 687 | WP_033570141.1 | putative ABC transporter ATP-binding protein YbbA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 179 a.a. Molecular weight: 19327.27 Da Isoelectric Point: 6.7055
>T274453 WP_024105035.1 NZ_CP119773:c2897674-2897138 [Dickeya fangzhongdai]
MVDTQSESNGVVVYAYQADTTYPGSKSFDCGNTVINSFVRSSLKKSVRDGNCAAKVLVKDETKELLGFCTFAAYSLEKSK
LAGVVSGSLPHELGVVRLIMLGVATKEQNKGYGQELLLEFFKQVKTIHESLPVKGVYLDADPAAIDFYIRLGFVQLNEPP
NAFGAVPMFLAIQHILAA
MVDTQSESNGVVVYAYQADTTYPGSKSFDCGNTVINSFVRSSLKKSVRDGNCAAKVLVKDETKELLGFCTFAAYSLEKSK
LAGVVSGSLPHELGVVRLIMLGVATKEQNKGYGQELLLEFFKQVKTIHESLPVKGVYLDADPAAIDFYIRLGFVQLNEPP
NAFGAVPMFLAIQHILAA
Download Length: 537 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|