Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2834717..2835342 | Replicon | chromosome |
| Accession | NZ_CP119773 | ||
| Organism | Dickeya fangzhongdai strain ZXC1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | E0SD87 |
| Locus tag | PQ617_RS12705 | Protein ID | WP_009114000.1 |
| Coordinates | 2834717..2834920 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A2K8QJA5 |
| Locus tag | PQ617_RS12710 | Protein ID | WP_042859087.1 |
| Coordinates | 2834974..2835342 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ617_RS12675 (PQ617_12675) | 2830355..2830693 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
| PQ617_RS12680 (PQ617_12680) | 2830736..2832028 | + | 1293 | WP_038661206.1 | ammonium transporter AmtB | - |
| PQ617_RS12685 (PQ617_12685) | 2832121..2832984 | - | 864 | WP_038918195.1 | acyl-CoA thioesterase II | - |
| PQ617_RS12690 (PQ617_12690) | 2833237..2833797 | + | 561 | WP_038918196.1 | YbaY family lipoprotein | - |
| PQ617_RS12695 (PQ617_12695) | 2833826..2834155 | - | 330 | WP_038918197.1 | MGMT family protein | - |
| PQ617_RS12705 (PQ617_12705) | 2834717..2834920 | - | 204 | WP_009114000.1 | HHA domain-containing protein | Toxin |
| PQ617_RS12710 (PQ617_12710) | 2834974..2835342 | - | 369 | WP_042859087.1 | Hha toxicity modulator TomB | Antitoxin |
| PQ617_RS12715 (PQ617_12715) | 2835850..2835993 | - | 144 | WP_013316871.1 | type B 50S ribosomal protein L36 | - |
| PQ617_RS12720 (PQ617_12720) | 2836009..2836260 | - | 252 | WP_038661187.1 | type B 50S ribosomal protein L31 | - |
| PQ617_RS12725 (PQ617_12725) | 2836431..2839577 | - | 3147 | WP_209126376.1 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8133.51 Da Isoelectric Point: 8.8500
>T274452 WP_009114000.1 NZ_CP119773:c2834920-2834717 [Dickeya fangzhongdai]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14200.07 Da Isoelectric Point: 5.1811
>AT274452 WP_042859087.1 NZ_CP119773:c2835342-2834974 [Dickeya fangzhongdai]
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSRGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDSELQKWKKSKSQLFRMFSEKSICTVVKT
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSRGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDSELQKWKKSKSQLFRMFSEKSICTVVKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X3RNQ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K8QJA5 |