Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 2602789..2603315 | Replicon | chromosome |
Accession | NZ_CP119773 | ||
Organism | Dickeya fangzhongdai strain ZXC1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | PQ617_RS11670 | Protein ID | WP_276195650.1 |
Coordinates | 2602789..2603094 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | PQ617_RS11675 | Protein ID | WP_276195651.1 |
Coordinates | 2603097..2603315 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ617_RS11650 (PQ617_11650) | 2598092..2598898 | + | 807 | WP_276195645.1 | oxidoreductase | - |
PQ617_RS11655 (PQ617_11655) | 2599137..2599309 | + | 173 | Protein_2256 | GNAT family N-acetyltransferase | - |
PQ617_RS11660 (PQ617_11660) | 2599383..2600494 | + | 1112 | WP_276195647.1 | IS3 family transposase | - |
PQ617_RS11665 (PQ617_11665) | 2601167..2602399 | - | 1233 | WP_276195649.1 | hypothetical protein | - |
PQ617_RS11670 (PQ617_11670) | 2602789..2603094 | - | 306 | WP_276195650.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PQ617_RS11675 (PQ617_11675) | 2603097..2603315 | - | 219 | WP_276195651.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PQ617_RS11680 (PQ617_11680) | 2603374..2604117 | - | 744 | WP_276195652.1 | MobC family replication-relaxation protein | - |
PQ617_RS11685 (PQ617_11685) | 2605020..2605370 | - | 351 | WP_276195653.1 | hypothetical protein | - |
PQ617_RS11690 (PQ617_11690) | 2605557..2605751 | + | 195 | WP_019844359.1 | YlcI/YnfO family protein | - |
PQ617_RS11695 (PQ617_11695) | 2605857..2607116 | - | 1260 | WP_276195654.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2584944..2604853 | 19909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11731.64 Da Isoelectric Point: 4.8500
>T274451 WP_276195650.1 NZ_CP119773:c2603094-2602789 [Dickeya fangzhongdai]
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPLIESHHLSEKVNKTLFPLLRIDGEDYRLMTTELSSVPVEVIGEVI
ADLSDCADEIKDAINLMFWGI
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPLIESHHLSEKVNKTLFPLLRIDGEDYRLMTTELSSVPVEVIGEVI
ADLSDCADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|