Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2306033..2306711 | Replicon | chromosome |
Accession | NZ_CP119773 | ||
Organism | Dickeya fangzhongdai strain ZXC1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2K8QJH4 |
Locus tag | PQ617_RS10480 | Protein ID | WP_049854564.1 |
Coordinates | 2306280..2306711 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A2K8QSU7 |
Locus tag | PQ617_RS10475 | Protein ID | WP_023637600.1 |
Coordinates | 2306033..2306299 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ617_RS10455 (PQ617_10455) | 2302480..2303130 | + | 651 | WP_038917839.1 | LysE family translocator | - |
PQ617_RS10460 (PQ617_10460) | 2303201..2303809 | - | 609 | WP_276219452.1 | HD domain-containing protein | - |
PQ617_RS10465 (PQ617_10465) | 2304020..2304670 | + | 651 | WP_038917842.1 | hemolysin III family protein | - |
PQ617_RS10470 (PQ617_10470) | 2304743..2305723 | - | 981 | WP_276219453.1 | tRNA-modifying protein YgfZ | - |
PQ617_RS10475 (PQ617_10475) | 2306033..2306299 | + | 267 | WP_023637600.1 | FAD assembly factor SdhE | Antitoxin |
PQ617_RS10480 (PQ617_10480) | 2306280..2306711 | + | 432 | WP_049854564.1 | protein YgfX | Toxin |
PQ617_RS10485 (PQ617_10485) | 2306811..2307329 | - | 519 | WP_107758698.1 | flavodoxin FldB | - |
PQ617_RS10490 (PQ617_10490) | 2307458..2308783 | - | 1326 | WP_276219454.1 | MFS transporter | - |
PQ617_RS10495 (PQ617_10495) | 2309046..2309945 | + | 900 | WP_038917846.1 | site-specific tyrosine recombinase XerD | - |
PQ617_RS10500 (PQ617_10500) | 2310034..2310750 | + | 717 | WP_038917847.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 16793.54 Da Isoelectric Point: 11.7737
>T274450 WP_049854564.1 NZ_CP119773:2306280-2306711 [Dickeya fangzhongdai]
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATTGKGHQRLWLASDSMGNEEWRLLRQLLLQHPLQGTESSRHH
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATTGKGHQRLWLASDSMGNEEWRLLRQLLLQHPLQGTESSRHH
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8QJH4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8QSU7 |