Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 2176424..2176950 | Replicon | chromosome |
Accession | NZ_CP119773 | ||
Organism | Dickeya fangzhongdai strain ZXC1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | PQ617_RS09855 | Protein ID | WP_276219395.1 |
Coordinates | 2176424..2176729 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | PQ617_RS09860 | Protein ID | WP_039534392.1 |
Coordinates | 2176732..2176950 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ617_RS09845 (PQ617_09845) | 2171644..2174277 | - | 2634 | WP_276219393.1 | DEAD/DEAH box helicase family protein | - |
PQ617_RS09850 (PQ617_09850) | 2174268..2175995 | - | 1728 | WP_276219394.1 | site-specific DNA-methyltransferase | - |
PQ617_RS09855 (PQ617_09855) | 2176424..2176729 | - | 306 | WP_276219395.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PQ617_RS09860 (PQ617_09860) | 2176732..2176950 | - | 219 | WP_039534392.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PQ617_RS09865 (PQ617_09865) | 2177009..2177752 | - | 744 | WP_276219397.1 | MobC family replication-relaxation protein | - |
PQ617_RS09870 (PQ617_09870) | 2178664..2179005 | - | 342 | WP_276219399.1 | hypothetical protein | - |
PQ617_RS09875 (PQ617_09875) | 2179146..2179316 | + | 171 | WP_162847981.1 | hypothetical protein | - |
PQ617_RS09880 (PQ617_09880) | 2179457..2180716 | - | 1260 | WP_276219401.1 | integrase arm-type DNA-binding domain-containing protein | - |
PQ617_RS09890 (PQ617_09890) | 2181116..2181691 | - | 576 | WP_276219632.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2163753..2180716 | 16963 | |
- | flank | IS/Tn | - | - | 2170350..2171558 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11753.58 Da Isoelectric Point: 4.8500
>T274449 WP_276219395.1 NZ_CP119773:c2176729-2176424 [Dickeya fangzhongdai]
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPIIEAHHLSEKVNKTLFPLIRIDSEDYRLMTTELSSVSVEVIGEVT
ADLGDYADEIKDAINLMFWGI
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPIIEAHHLSEKVNKTLFPLIRIDSEDYRLMTTELSSVSVEVIGEVT
ADLGDYADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|