Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-sanaA/VapC-DUF6088 |
| Location | 2040947..2041875 | Replicon | chromosome |
| Accession | NZ_CP119773 | ||
| Organism | Dickeya fangzhongdai strain ZXC1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PQ617_RS09240 | Protein ID | WP_033576633.1 |
| Coordinates | 2040947..2041351 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | sanaA | Uniprot ID | - |
| Locus tag | PQ617_RS09245 | Protein ID | WP_276219306.1 |
| Coordinates | 2041432..2041875 (+) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ617_RS09205 (PQ617_09205) | 2036353..2037180 | + | 828 | WP_276219296.1 | ribbon-helix-helix domain-containing protein | - |
| PQ617_RS09210 (PQ617_09210) | 2037319..2038185 | + | 867 | WP_276219298.1 | GTPase family protein | - |
| PQ617_RS09215 (PQ617_09215) | 2038282..2039103 | + | 822 | WP_276219300.1 | DUF932 domain-containing protein | - |
| PQ617_RS09220 (PQ617_09220) | 2039134..2039607 | + | 474 | WP_012768688.1 | DNA repair protein RadC | - |
| PQ617_RS09225 (PQ617_09225) | 2039671..2040021 | + | 351 | WP_276219302.1 | TA system toxin CbtA family protein | - |
| PQ617_RS09230 (PQ617_09230) | 2040122..2040655 | + | 534 | WP_276219304.1 | hypothetical protein | - |
| PQ617_RS09235 (PQ617_09235) | 2040717..2040947 | + | 231 | WP_033576634.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PQ617_RS09240 (PQ617_09240) | 2040947..2041351 | + | 405 | WP_033576633.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PQ617_RS09245 (PQ617_09245) | 2041432..2041875 | + | 444 | WP_276219306.1 | DUF6088 family protein | Antitoxin |
| PQ617_RS09250 (PQ617_09250) | 2041964..2042764 | + | 801 | WP_276219308.1 | helix-turn-helix transcriptional regulator | - |
| PQ617_RS09255 (PQ617_09255) | 2042987..2043232 | - | 246 | WP_276219310.1 | hypothetical protein | - |
| PQ617_RS09265 (PQ617_09265) | 2044484..2044918 | - | 435 | WP_276219313.1 | methyltransferase domain-containing protein | - |
| PQ617_RS09270 (PQ617_09270) | 2044929..2045186 | - | 258 | WP_276219315.1 | YjhX family toxin | - |
| PQ617_RS09275 (PQ617_09275) | 2045638..2045976 | - | 339 | WP_049855263.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2034896..2047062 | 12166 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15016.30 Da Isoelectric Point: 7.9968
>T274448 WP_033576633.1 NZ_CP119773:2040947-2041351 [Dickeya fangzhongdai]
MLKYLLDTNICIYTIKNKPQEVREAFQRYYGQFAISSITLMELIYGAEKSANPEKNLAVIEGFSARLEIQPYGFDAAVHT
GQIRAELAKKGTPIGPYDAMLAGHARSAGLILVTNNVREFERVPGLRVENWLNP
MLKYLLDTNICIYTIKNKPQEVREAFQRYYGQFAISSITLMELIYGAEKSANPEKNLAVIEGFSARLEIQPYGFDAAVHT
GQIRAELAKKGTPIGPYDAMLAGHARSAGLILVTNNVREFERVPGLRVENWLNP
Download Length: 405 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16491.13 Da Isoelectric Point: 10.9373
>AT274448 WP_276219306.1 NZ_CP119773:2041432-2041875 [Dickeya fangzhongdai]
MTIKTRIQSRLKRSKRYVFTRDDFKDLAGYDQVGRVLRELVKEGQLLKVGYGVYTKARKNVITGRLMPASPGGSAAVVIE
ALERLNVPYRFVGATAAYSSGKSTQIPAFLEIEILSRFKRVLTIGNNKLNGRFERFDVGLTVNENGF
MTIKTRIQSRLKRSKRYVFTRDDFKDLAGYDQVGRVLRELVKEGQLLKVGYGVYTKARKNVITGRLMPASPGGSAAVVIE
ALERLNVPYRFVGATAAYSSGKSTQIPAFLEIEILSRFKRVLTIGNNKLNGRFERFDVGLTVNENGF
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|