Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2040717..2041351 Replicon chromosome
Accession NZ_CP119773
Organism Dickeya fangzhongdai strain ZXC1

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PQ617_RS09240 Protein ID WP_033576633.1
Coordinates 2040947..2041351 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PQ617_RS09235 Protein ID WP_033576634.1
Coordinates 2040717..2040947 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQ617_RS09205 (PQ617_09205) 2036353..2037180 + 828 WP_276219296.1 ribbon-helix-helix domain-containing protein -
PQ617_RS09210 (PQ617_09210) 2037319..2038185 + 867 WP_276219298.1 GTPase family protein -
PQ617_RS09215 (PQ617_09215) 2038282..2039103 + 822 WP_276219300.1 DUF932 domain-containing protein -
PQ617_RS09220 (PQ617_09220) 2039134..2039607 + 474 WP_012768688.1 DNA repair protein RadC -
PQ617_RS09225 (PQ617_09225) 2039671..2040021 + 351 WP_276219302.1 TA system toxin CbtA family protein -
PQ617_RS09230 (PQ617_09230) 2040122..2040655 + 534 WP_276219304.1 hypothetical protein -
PQ617_RS09235 (PQ617_09235) 2040717..2040947 + 231 WP_033576634.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQ617_RS09240 (PQ617_09240) 2040947..2041351 + 405 WP_033576633.1 tRNA(fMet)-specific endonuclease VapC Toxin
PQ617_RS09245 (PQ617_09245) 2041432..2041875 + 444 WP_276219306.1 DUF6088 family protein -
PQ617_RS09250 (PQ617_09250) 2041964..2042764 + 801 WP_276219308.1 helix-turn-helix transcriptional regulator -
PQ617_RS09255 (PQ617_09255) 2042987..2043232 - 246 WP_276219310.1 hypothetical protein -
PQ617_RS09265 (PQ617_09265) 2044484..2044918 - 435 WP_276219313.1 methyltransferase domain-containing protein -
PQ617_RS09270 (PQ617_09270) 2044929..2045186 - 258 WP_276219315.1 YjhX family toxin -
PQ617_RS09275 (PQ617_09275) 2045638..2045976 - 339 WP_049855263.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2034896..2047062 12166


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15016.30 Da        Isoelectric Point: 7.9968

>T274447 WP_033576633.1 NZ_CP119773:2040947-2041351 [Dickeya fangzhongdai]
MLKYLLDTNICIYTIKNKPQEVREAFQRYYGQFAISSITLMELIYGAEKSANPEKNLAVIEGFSARLEIQPYGFDAAVHT
GQIRAELAKKGTPIGPYDAMLAGHARSAGLILVTNNVREFERVPGLRVENWLNP

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8647.66 Da        Isoelectric Point: 4.5580

>AT274447 WP_033576634.1 NZ_CP119773:2040717-2040947 [Dickeya fangzhongdai]
MEKATVFKSNRSQAVRLPKAVALPDDVRHVDIVAIGRTRIITPAGESWDSWFDEASVTPDFMSTREQPDEQIRDDF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References