Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 883632..884228 | Replicon | chromosome |
| Accession | NZ_CP119772 | ||
| Organism | Pseudomonas sp. D3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P3S72_RS03800 | Protein ID | WP_247407437.1 |
| Coordinates | 883926..884228 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | P3S72_RS03795 | Protein ID | WP_198718356.1 |
| Coordinates | 883632..883922 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3S72_RS03775 (P3S72_03775) | 880004..882079 | - | 2076 | WP_276196308.1 | TonB-dependent copper receptor | - |
| P3S72_RS03780 (P3S72_03780) | 882173..882598 | - | 426 | WP_276196309.1 | DUF2946 domain-containing protein | - |
| P3S72_RS03785 (P3S72_03785) | 882610..883092 | - | 483 | WP_276196310.1 | copper chaperone PCu(A)C | - |
| P3S72_RS03790 (P3S72_03790) | 883140..883535 | - | 396 | WP_247407434.1 | DUF2946 domain-containing protein | - |
| P3S72_RS03795 (P3S72_03795) | 883632..883922 | - | 291 | WP_198718356.1 | putative addiction module antidote protein | Antitoxin |
| P3S72_RS03800 (P3S72_03800) | 883926..884228 | - | 303 | WP_247407437.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P3S72_RS03805 (P3S72_03805) | 884602..885321 | - | 720 | WP_276196311.1 | cobalt-precorrin-6A reductase | - |
| P3S72_RS03810 (P3S72_03810) | 885318..886523 | - | 1206 | WP_276196312.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
| P3S72_RS03815 (P3S72_03815) | 886562..887914 | + | 1353 | WP_276196313.1 | precorrin-3B synthase | - |
| P3S72_RS03820 (P3S72_03820) | 887907..888533 | + | 627 | WP_276196314.1 | precorrin-8X methylmutase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11466.30 Da Isoelectric Point: 8.5041
>T274443 WP_247407437.1 NZ_CP119772:c884228-883926 [Pseudomonas sp. D3]
MIEFEESIEFVKWLEAMRDPLAKVRVVTRLRMAQAGNFGDCEAVGEGVCEMRIHQGPGYRVYFTRRDKVVYLLLMGGDKS
TQSRDIKRAIHMAKNLGSQE
MIEFEESIEFVKWLEAMRDPLAKVRVVTRLRMAQAGNFGDCEAVGEGVCEMRIHQGPGYRVYFTRRDKVVYLLLMGGDKS
TQSRDIKRAIHMAKNLGSQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|