Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4763860..4764482 | Replicon | chromosome |
| Accession | NZ_CP119754 | ||
| Organism | Superficieibacter sp. HKU1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P0H77_RS22650 | Protein ID | WP_276160102.1 |
| Coordinates | 4763860..4764231 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P0H77_RS22655 | Protein ID | WP_276160106.1 |
| Coordinates | 4764228..4764482 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0H77_RS22635 (P0H77_22640) | 4761356..4762258 | + | 903 | WP_176919603.1 | formate dehydrogenase subunit beta | - |
| P0H77_RS22640 (P0H77_22645) | 4762255..4762890 | + | 636 | WP_276160093.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P0H77_RS22645 (P0H77_22650) | 4762887..4763816 | + | 930 | WP_276160096.1 | formate dehydrogenase accessory protein FdhE | - |
| P0H77_RS22650 (P0H77_22655) | 4763860..4764231 | - | 372 | WP_276160102.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P0H77_RS22655 (P0H77_22660) | 4764228..4764482 | - | 255 | WP_276160106.1 | CopG family transcriptional regulator | Antitoxin |
| P0H77_RS22660 (P0H77_22665) | 4765149..4765691 | - | 543 | WP_276160108.1 | shikimate kinase | - |
| P0H77_RS22665 (P0H77_22670) | 4765881..4766045 | + | 165 | WP_276160109.1 | hypothetical protein | - |
| P0H77_RS22670 (P0H77_22675) | 4767297..4768658 | + | 1362 | WP_276160110.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13912.11 Da Isoelectric Point: 9.4615
>T274437 WP_276160102.1 NZ_CP119754:c4764231-4763860 [Superficieibacter sp. HKU1]
MKGKALFDTNILIDLFNGHREAMSALEAYPPQHAISLVTWMEVMVGAKKYHREHQTRMALSAFNIIGISQDIAERSVNLR
QEFGLKLPDAIILATAQHHRYTMVTRNTKDFAGIPGVVTPYQF
MKGKALFDTNILIDLFNGHREAMSALEAYPPQHAISLVTWMEVMVGAKKYHREHQTRMALSAFNIIGISQDIAERSVNLR
QEFGLKLPDAIILATAQHHRYTMVTRNTKDFAGIPGVVTPYQF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|