Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3752287..3752944 | Replicon | chromosome |
Accession | NZ_CP119754 | ||
Organism | Superficieibacter sp. HKU1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | P0H77_RS17770 | Protein ID | WP_276158608.1 |
Coordinates | 3752287..3752697 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | P0H77_RS17775 | Protein ID | WP_276158609.1 |
Coordinates | 3752678..3752944 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0H77_RS17750 (P0H77_17750) | 3748280..3750013 | - | 1734 | WP_276158604.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P0H77_RS17755 (P0H77_17755) | 3750019..3750732 | - | 714 | WP_276158605.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P0H77_RS17760 (P0H77_17760) | 3750757..3751653 | - | 897 | WP_276158606.1 | site-specific tyrosine recombinase XerD | - |
P0H77_RS17765 (P0H77_17765) | 3751755..3752276 | + | 522 | WP_276158607.1 | flavodoxin FldB | - |
P0H77_RS17770 (P0H77_17770) | 3752287..3752697 | - | 411 | WP_276158608.1 | protein YgfX | Toxin |
P0H77_RS17775 (P0H77_17775) | 3752678..3752944 | - | 267 | WP_276158609.1 | FAD assembly factor SdhE | Antitoxin |
P0H77_RS17780 (P0H77_17780) | 3753193..3754176 | + | 984 | WP_276158610.1 | tRNA-modifying protein YgfZ | - |
P0H77_RS17785 (P0H77_17785) | 3754216..3754875 | - | 660 | WP_276158611.1 | hemolysin III family protein | - |
P0H77_RS17790 (P0H77_17790) | 3755147..3755875 | + | 729 | WP_276165172.1 | MurR/RpiR family transcriptional regulator | - |
P0H77_RS17795 (P0H77_17795) | 3755991..3757424 | + | 1434 | WP_276158612.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16194.34 Da Isoelectric Point: 12.0140
>T274435 WP_276158608.1 NZ_CP119754:c3752697-3752287 [Superficieibacter sp. HKU1]
VVLWQSDLRVSWRSQWLSLLLHGVVAALVLLMPWPLSYLPLWLLLLSLVVFDCVRSQRRINACQGEIKLMMNSRLRWQGQ
EWEITGAPWMLKSGMMLRLRKLGSRRRQHLWLAADSMESGEWRDLRRMLMQQPARR
VVLWQSDLRVSWRSQWLSLLLHGVVAALVLLMPWPLSYLPLWLLLLSLVVFDCVRSQRRINACQGEIKLMMNSRLRWQGQ
EWEITGAPWMLKSGMMLRLRKLGSRRRQHLWLAADSMESGEWRDLRRMLMQQPARR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|