Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | KacT-ataR/DUF1778(antitoxin) |
Location | 353121..353924 | Replicon | chromosome |
Accession | NZ_CP119754 | ||
Organism | Superficieibacter sp. HKU1 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | P0H77_RS01680 | Protein ID | WP_276161710.1 |
Coordinates | 353394..353924 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | P0H77_RS01675 | Protein ID | WP_176919441.1 |
Coordinates | 353121..353390 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0H77_RS01660 (P0H77_01660) | 349149..350003 | + | 855 | WP_176919445.1 | RNA polymerase sigma factor RpoH | - |
P0H77_RS01665 (P0H77_01665) | 350179..351444 | + | 1266 | WP_276161694.1 | 4-aminobutyrate--2-oxoglutarate transaminase | - |
P0H77_RS01670 (P0H77_01670) | 351662..352765 | + | 1104 | WP_103675794.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
P0H77_RS01675 (P0H77_01675) | 353121..353390 | + | 270 | WP_176919441.1 | DUF1778 domain-containing protein | Antitoxin |
P0H77_RS01680 (P0H77_01680) | 353394..353924 | + | 531 | WP_276161710.1 | GNAT family N-acetyltransferase | Toxin |
P0H77_RS01685 (P0H77_01685) | 353937..355946 | - | 2010 | WP_276161714.1 | DUF2207 domain-containing protein | - |
P0H77_RS01690 (P0H77_01690) | 356250..356633 | - | 384 | WP_276161728.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
P0H77_RS01695 (P0H77_01695) | 357056..358165 | + | 1110 | WP_276161734.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 19668.52 Da Isoelectric Point: 7.0493
>T274426 WP_276161710.1 NZ_CP119754:353394-353924 [Superficieibacter sp. HKU1]
VDELIIELFADATEYNLNEFDCGEETLNRFLFEHLSRQHHRKILRGYVLRTTGPVPAVLGYYTLSGSCFEKASLPSKTQQ
KQIPYRNVPSITLGRLAVDKRLQGQGWGTMLVTHAMKVIFGASQTVGIHGMFVEALNDNARAFYLSLGFIPLSGENNHAL
FYPVKSIESLFASDIA
VDELIIELFADATEYNLNEFDCGEETLNRFLFEHLSRQHHRKILRGYVLRTTGPVPAVLGYYTLSGSCFEKASLPSKTQQ
KQIPYRNVPSITLGRLAVDKRLQGQGWGTMLVTHAMKVIFGASQTVGIHGMFVEALNDNARAFYLSLGFIPLSGENNHAL
FYPVKSIESLFASDIA
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|