Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 81705..82423 | Replicon | chromosome |
Accession | NZ_CP119754 | ||
Organism | Superficieibacter sp. HKU1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A822WUK4 |
Locus tag | P0H77_RS00405 | Protein ID | WP_071605960.1 |
Coordinates | 81705..82025 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A822X2D3 |
Locus tag | P0H77_RS00410 | Protein ID | WP_054627869.1 |
Coordinates | 82067..82423 (-) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0H77_RS00380 (P0H77_00380) | 77655..77942 | - | 288 | WP_276160739.1 | SymE family type I addiction module toxin | - |
P0H77_RS00385 (P0H77_00385) | 78080..78268 | + | 189 | WP_276160746.1 | toxin-antitoxin system HicB family antitoxin | - |
P0H77_RS00390 (P0H77_00390) | 78456..79490 | - | 1035 | WP_276160749.1 | CHAT domain-containing protein | - |
P0H77_RS00395 (P0H77_00395) | 79761..80180 | - | 420 | WP_276160753.1 | toll/interleukin-1 receptor domain-containing protein | - |
P0H77_RS00400 (P0H77_00400) | 80867..81214 | + | 348 | WP_276160755.1 | DUF6404 family protein | - |
P0H77_RS00405 (P0H77_00405) | 81705..82025 | - | 321 | WP_071605960.1 | TA system toxin CbtA family protein | Toxin |
P0H77_RS00410 (P0H77_00410) | 82067..82423 | - | 357 | WP_054627869.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P0H77_RS00415 (P0H77_00415) | 82455..82676 | - | 222 | WP_054627868.1 | DUF987 family protein | - |
P0H77_RS00420 (P0H77_00420) | 82685..83155 | - | 471 | WP_276160779.1 | DNA repair protein RadC | - |
P0H77_RS00425 (P0H77_00425) | 83225..84046 | - | 822 | WP_044599778.1 | DUF932 domain-containing protein | - |
P0H77_RS00430 (P0H77_00430) | 84739..85578 | - | 840 | WP_137574673.1 | hypothetical protein | - |
P0H77_RS00435 (P0H77_00435) | 85638..86072 | - | 435 | WP_054627865.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12227.83 Da Isoelectric Point: 6.3229
>T274423 WP_071605960.1 NZ_CP119754:c82025-81705 [Superficieibacter sp. HKU1]
MHISTVPKTVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKSF
SWQDQEPWITSLDVHRAQSNLGLKRP
MHISTVPKTVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKSF
SWQDQEPWITSLDVHRAQSNLGLKRP
Download Length: 321 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13069.72 Da Isoelectric Point: 5.9473
>AT274423 WP_054627869.1 NZ_CP119754:c82423-82067 [Superficieibacter sp. HKU1]
MQSTTISGTSAENTSCLQWGLKRNITPCFGARLVQEGNRIYFLADRAGFNGSFSDAEALSLDQAFPLMVKQLERMLTTGE
LDPHNQHCVTLHHNGLTCEADTLGSYGYVYIAIYPHQL
MQSTTISGTSAENTSCLQWGLKRNITPCFGARLVQEGNRIYFLADRAGFNGSFSDAEALSLDQAFPLMVKQLERMLTTGE
LDPHNQHCVTLHHNGLTCEADTLGSYGYVYIAIYPHQL
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A822WUK4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A822X2D3 |