Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1144789..1145441 | Replicon | chromosome |
| Accession | NZ_CP119753 | ||
| Organism | Microbacter sp. GSS18 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P0L94_RS05430 | Protein ID | WP_276179984.1 |
| Coordinates | 1144789..1145178 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P0L94_RS05435 | Protein ID | WP_276179986.1 |
| Coordinates | 1145187..1145441 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0L94_RS05405 (P0L94_05405) | 1139868..1140845 | + | 978 | WP_276179974.1 | cysteine synthase family protein | - |
| P0L94_RS05410 (P0L94_05410) | 1140887..1141633 | + | 747 | WP_276179976.1 | SUMF1/EgtB/PvdO family nonheme iron enzyme | - |
| P0L94_RS05415 (P0L94_05415) | 1141713..1142090 | + | 378 | WP_276179978.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| P0L94_RS05420 (P0L94_05420) | 1142087..1143757 | + | 1671 | WP_276179980.1 | SulP family inorganic anion transporter | - |
| P0L94_RS05425 (P0L94_05425) | 1143868..1144626 | + | 759 | WP_276179982.1 | MBL fold metallo-hydrolase | - |
| P0L94_RS05430 (P0L94_05430) | 1144789..1145178 | - | 390 | WP_276179984.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P0L94_RS05435 (P0L94_05435) | 1145187..1145441 | - | 255 | WP_276179986.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P0L94_RS05440 (P0L94_05440) | 1145532..1146452 | + | 921 | WP_276179987.1 | AEC family transporter | - |
| P0L94_RS05445 (P0L94_05445) | 1146620..1147177 | + | 558 | WP_276179989.1 | DUF308 domain-containing protein | - |
| P0L94_RS05450 (P0L94_05450) | 1147232..1149223 | - | 1992 | WP_276179991.1 | S9 family peptidase | - |
| P0L94_RS05455 (P0L94_05455) | 1149226..1149990 | - | 765 | WP_276179993.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13434.04 Da Isoelectric Point: 5.1029
>T274422 WP_276179984.1 NZ_CP119753:c1145178-1144789 [Microbacter sp. GSS18]
VADTSALVAVVFGEADARAFASVLAAHAGDVSVSAATLVEARIVVEGRQGTEAAADLDRLLTRLGAHVVAVDDAQASLAT
SAWRRFGKGRHDAGLNFGDCFSYALSKHLDVPLLYKGDDFSRTDVASAM
VADTSALVAVVFGEADARAFASVLAAHAGDVSVSAATLVEARIVVEGRQGTEAAADLDRLLTRLGAHVVAVDDAQASLAT
SAWRRFGKGRHDAGLNFGDCFSYALSKHLDVPLLYKGDDFSRTDVASAM
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|