Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 135630..136216 | Replicon | chromosome |
| Accession | NZ_CP119753 | ||
| Organism | Microbacter sp. GSS18 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | P0L94_RS00630 | Protein ID | WP_276178145.1 |
| Coordinates | 135630..135998 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | P0L94_RS00635 | Protein ID | WP_276178147.1 |
| Coordinates | 135995..136216 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0L94_RS00605 (P0L94_00605) | 131040..131687 | + | 648 | WP_276178135.1 | SDR family oxidoreductase | - |
| P0L94_RS00610 (P0L94_00610) | 132099..132938 | - | 840 | WP_276178137.1 | NADPH-dependent oxidoreductase | - |
| P0L94_RS00615 (P0L94_00615) | 132996..133976 | - | 981 | WP_276178139.1 | acyl-CoA desaturase | - |
| P0L94_RS00620 (P0L94_00620) | 134341..134658 | - | 318 | WP_276178141.1 | hypothetical protein | - |
| P0L94_RS00625 (P0L94_00625) | 134892..135626 | + | 735 | WP_276178143.1 | aminoglycoside 3'-phosphotransferase | - |
| P0L94_RS00630 (P0L94_00630) | 135630..135998 | - | 369 | WP_276178145.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P0L94_RS00635 (P0L94_00635) | 135995..136216 | - | 222 | WP_276178147.1 | antitoxin | Antitoxin |
| P0L94_RS00640 (P0L94_00640) | 136367..136819 | - | 453 | WP_276178149.1 | hypothetical protein | - |
| P0L94_RS00645 (P0L94_00645) | 136937..138208 | - | 1272 | WP_276178151.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| P0L94_RS00650 (P0L94_00650) | 138322..139767 | + | 1446 | Protein_129 | cryptochrome/photolyase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 12740.62 Da Isoelectric Point: 11.6142
>T274421 WP_276178145.1 NZ_CP119753:c135998-135630 [Microbacter sp. GSS18]
VSDALPLLRRGHIVLVNLDPAVGSEAAKTRPAIVVSNNTANASALRSDRGVITVVPLTSNVARVHGFQVLVDPESSGLTR
TSKAQAERVRTVSIARVSAVTGWLGAEQMGAVDAALRLHLSL
VSDALPLLRRGHIVLVNLDPAVGSEAAKTRPAIVVSNNTANASALRSDRGVITVVPLTSNVARVHGFQVLVDPESSGLTR
TSKAQAERVRTVSIARVSAVTGWLGAEQMGAVDAALRLHLSL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|