Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 113548..114107 Replicon plasmid pE15-3
Accession NZ_CP119749
Organism Escherichia coli strain E15

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag P1J19_RS26680 Protein ID WP_000421257.1
Coordinates 113832..114107 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0H2XL20
Locus tag P1J19_RS26675 Protein ID WP_012006537.1
Coordinates 113548..113832 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J19_RS26650 (P1J19_26650) 109306..110067 - 762 WP_000020503.1 ABC transporter ATP-binding protein -
P1J19_RS26655 (P1J19_26655) 110067..111104 - 1038 WP_032353476.1 iron ABC transporter permease -
P1J19_RS26660 (P1J19_26660) 111104..112102 - 999 WP_032353474.1 ABC transporter substrate-binding protein -
P1J19_RS26665 (P1J19_26665) 112252..112410 - 159 Protein_130 integrase core domain-containing protein -
P1J19_RS26670 (P1J19_26670) 112457..113047 - 591 WP_000086536.1 recombinase family protein -
P1J19_RS26675 (P1J19_26675) 113548..113832 + 285 WP_012006537.1 ribbon-helix-helix domain-containing protein Antitoxin
P1J19_RS26680 (P1J19_26680) 113832..114107 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J19_RS26685 (P1J19_26685) 114246..115783 - 1538 Protein_134 IS66-like element ISEc8 family transposase -
P1J19_RS26690 (P1J19_26690) 115833..116180 - 348 WP_000612591.1 IS66 family insertion sequence element accessory protein TnpB -
P1J19_RS26695 (P1J19_26695) 116177..116557 - 381 WP_001171523.1 transposase -
P1J19_RS26700 (P1J19_26700) 116665..117391 + 727 Protein_137 IS256-like element IS1414 family transposase -
P1J19_RS26705 (P1J19_26705) 117445..118803 - 1359 WP_032353707.1 esterase-like activity of phytase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..129738 129738
- inside IScluster/Tn - - 112457..124901 12444


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T274420 WP_000421257.1 NZ_CP119749:113832-114107 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10501.96 Da        Isoelectric Point: 6.4632

>AT274420 WP_012006537.1 NZ_CP119749:113548-113832 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVKSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2XL20

References