Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 101524..102167 Replicon plasmid pE15-3
Accession NZ_CP119749
Organism Escherichia coli strain E15

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag P1J19_RS26600 Protein ID WP_001034046.1
Coordinates 101524..101940 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag P1J19_RS26605 Protein ID WP_001261278.1
Coordinates 101937..102167 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J19_RS26570 (P1J19_26570) 97003..97308 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
P1J19_RS26575 (P1J19_26575) 97310..97528 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
P1J19_RS26580 (P1J19_26580) 98510..98641 + 132 Protein_113 transposase -
P1J19_RS26585 (P1J19_26585) 98689..98874 + 186 WP_032353630.1 hypothetical protein -
P1J19_RS26590 (P1J19_26590) 98906..99358 - 453 WP_032353631.1 acyltransferase -
P1J19_RS26600 (P1J19_26600) 101524..101940 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
P1J19_RS26605 (P1J19_26605) 101937..102167 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P1J19_RS26610 (P1J19_26610) 102352..103839 + 1488 Protein_119 IncI1-type relaxase NikB -
P1J19_RS26615 (P1J19_26615) 104224..104613 + 390 WP_045146805.1 cytochrome b562 -
P1J19_RS26620 (P1J19_26620) 104844..105541 + 698 WP_225877546.1 IS1-like element IS1A family transposase -
P1J19_RS26625 (P1J19_26625) 105723..106586 + 864 WP_021534910.1 endonuclease/exonuclease/phosphatase family protein -
P1J19_RS26630 (P1J19_26630) 106846..107040 - 195 Protein_123 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..129738 129738


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T274419 WP_001034046.1 NZ_CP119749:c101940-101524 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT274419 WP_001261278.1 NZ_CP119749:c102167-101937 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References