Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 97003..97528 Replicon plasmid pE15-3
Accession NZ_CP119749
Organism Escherichia coli strain E15

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag P1J19_RS26570 Protein ID WP_001159871.1
Coordinates 97003..97308 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag P1J19_RS26575 Protein ID WP_000813630.1
Coordinates 97310..97528 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J19_RS26545 (P1J19_26545) 93353..94015 + 663 Protein_106 colicin-like pore-forming protein -
P1J19_RS26550 (P1J19_26550) 94033..94560 - 528 WP_032353548.1 colicin B immunity protein -
P1J19_RS26555 (P1J19_26555) 94802..95617 + 816 WP_032494159.1 lipid II-degrading bacteriocin colicin M -
P1J19_RS26560 (P1J19_26560) 95667..96020 - 354 WP_000864812.1 colicin M immunity protein -
P1J19_RS26565 (P1J19_26565) 96193..97002 - 810 WP_045145707.1 site-specific integrase -
P1J19_RS26570 (P1J19_26570) 97003..97308 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
P1J19_RS26575 (P1J19_26575) 97310..97528 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P1J19_RS26580 (P1J19_26580) 98510..98641 + 132 Protein_113 transposase -
P1J19_RS26585 (P1J19_26585) 98689..98874 + 186 WP_032353630.1 hypothetical protein -
P1J19_RS26590 (P1J19_26590) 98906..99358 - 453 WP_032353631.1 acyltransferase -
P1J19_RS26600 (P1J19_26600) 101524..101940 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
P1J19_RS26605 (P1J19_26605) 101937..102167 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..129738 129738


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T274418 WP_001159871.1 NZ_CP119749:c97308-97003 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT274418 WP_000813630.1 NZ_CP119749:c97528-97310 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References