Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3647833..3648670 | Replicon | chromosome |
| Accession | NZ_CP119746 | ||
| Organism | Escherichia coli strain E15 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | P1J19_RS17785 | Protein ID | WP_000227784.1 |
| Coordinates | 3648128..3648670 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | P1J19_RS17780 | Protein ID | WP_001297137.1 |
| Coordinates | 3647833..3648144 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J19_RS17755 (3642853) | 3642853..3643800 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| P1J19_RS17760 (3643822) | 3643822..3645813 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| P1J19_RS17765 (3645803) | 3645803..3646417 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| P1J19_RS17770 (3646417) | 3646417..3646746 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| P1J19_RS17775 (3646758) | 3646758..3647648 | + | 891 | WP_000971336.1 | heme o synthase | - |
| P1J19_RS17780 (3647833) | 3647833..3648144 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| P1J19_RS17785 (3648128) | 3648128..3648670 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| P1J19_RS17795 (3649613) | 3649613..3650437 | - | 825 | Protein_3481 | tetratricopeptide repeat protein | - |
| P1J19_RS17800 (3650845) | 3650845..3652209 | + | 1365 | WP_001000974.1 | MFS transporter | - |
| P1J19_RS17805 (3652443) | 3652443..3653423 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T274404 WP_000227784.1 NZ_CP119746:3648128-3648670 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|