Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3613757..3614375 | Replicon | chromosome |
| Accession | NZ_CP119746 | ||
| Organism | Escherichia coli strain E15 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | P1J19_RS17615 | Protein ID | WP_001291435.1 |
| Coordinates | 3614157..3614375 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | P1J19_RS17610 | Protein ID | WP_000344800.1 |
| Coordinates | 3613757..3614131 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J19_RS17600 (3608846) | 3608846..3610039 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P1J19_RS17605 (3610062) | 3610062..3613211 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| P1J19_RS17610 (3613757) | 3613757..3614131 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| P1J19_RS17615 (3614157) | 3614157..3614375 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| P1J19_RS17620 (3614546) | 3614546..3615097 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| P1J19_RS17625 (3615213) | 3615213..3615683 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| P1J19_RS17630 (3615847) | 3615847..3617397 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| P1J19_RS17635 (3617439) | 3617439..3617792 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
| P1J19_RS17645 (3618171) | 3618171..3618482 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| P1J19_RS17650 (3618513) | 3618513..3619085 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T274403 WP_001291435.1 NZ_CP119746:3614157-3614375 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT274403 WP_000344800.1 NZ_CP119746:3613757-3614131 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |