Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1407155..1407780 | Replicon | chromosome |
Accession | NZ_CP119746 | ||
Organism | Escherichia coli strain E15 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P1J19_RS06925 | Protein ID | WP_000911330.1 |
Coordinates | 1407382..1407780 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | P1J19_RS06920 | Protein ID | WP_000450524.1 |
Coordinates | 1407155..1407382 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J19_RS06895 (1402958) | 1402958..1403428 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
P1J19_RS06900 (1403428) | 1403428..1404000 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
P1J19_RS06905 (1404146) | 1404146..1405024 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
P1J19_RS06910 (1405041) | 1405041..1406075 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
P1J19_RS06915 (1406288) | 1406288..1407001 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
P1J19_RS06920 (1407155) | 1407155..1407382 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P1J19_RS06925 (1407382) | 1407382..1407780 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P1J19_RS06930 (1407927) | 1407927..1408790 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
P1J19_RS06935 (1408805) | 1408805..1410820 | + | 2016 | WP_000829292.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
P1J19_RS06940 (1410894) | 1410894..1411592 | + | 699 | WP_000679812.1 | esterase | - |
P1J19_RS06945 (1411673) | 1411673..1411873 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T274395 WP_000911330.1 NZ_CP119746:1407382-1407780 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|