Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 780626..781424 Replicon chromosome
Accession NZ_CP119746
Organism Escherichia coli strain E15

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag P1J19_RS03770 Protein ID WP_000854735.1
Coordinates 780626..781003 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag P1J19_RS03775 Protein ID WP_001285415.1
Coordinates 781050..781424 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J19_RS03740 (776772) 776772..777905 + 1134 Protein_733 Accessory colonization factor AcfD -
P1J19_RS03745 (778323) 778323..778649 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
P1J19_RS03750 (778646) 778646..778909 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
P1J19_RS03755 (778981) 778981..779847 - 867 WP_001280433.1 DUF4942 domain-containing protein -
P1J19_RS03760 (779932) 779932..780129 - 198 WP_000839291.1 DUF957 domain-containing protein -
P1J19_RS03765 (780141) 780141..780629 - 489 WP_000761677.1 DUF5983 family protein -
P1J19_RS03770 (780626) 780626..781003 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
P1J19_RS03775 (781050) 781050..781424 - 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P1J19_RS03780 (781504) 781504..781725 - 222 WP_000692309.1 DUF987 domain-containing protein -
P1J19_RS03785 (781788) 781788..782264 - 477 WP_001366855.1 RadC family protein -
P1J19_RS03790 (782280) 782280..782759 - 480 WP_000844100.1 antirestriction protein -
P1J19_RS03795 (782841) 782841..783659 - 819 WP_276170499.1 DUF932 domain-containing protein -
P1J19_RS03800 (783749) 783749..783982 - 234 WP_001278287.1 DUF905 family protein -
P1J19_RS03805 (783988) 783988..784665 - 678 WP_001097302.1 hypothetical protein -
P1J19_RS03810 (784813) 784813..785493 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 778323..841879 63556


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T274392 WP_000854735.1 NZ_CP119746:c781003-780626 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT274392 WP_001285415.1 NZ_CP119746:c781424-781050 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References