Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 55680..56215 Replicon plasmid pE94-5
Accession NZ_CP119745
Organism Escherichia coli strain E94

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag P1J23_RS29030 Protein ID WP_169030134.1
Coordinates 55928..56215 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag P1J23_RS29025 Protein ID WP_001132895.1
Coordinates 55680..55931 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J23_RS28995 (P1J23_28995) 51290..51613 + 324 Protein_74 DDE-type integrase/transposase/recombinase -
P1J23_RS29000 (P1J23_29000) 51719..51856 - 138 WP_169030146.1 hypothetical protein -
P1J23_RS29005 (P1J23_29005) 51998..52363 + 366 WP_000124098.1 hypothetical protein -
P1J23_RS29010 (P1J23_29010) 52363..53550 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
P1J23_RS29015 (P1J23_29015) 53773..54045 + 273 WP_011310366.1 hypothetical protein -
P1J23_RS29020 (P1J23_29020) 54026..55234 + 1209 WP_169030147.1 IS91 family transposase -
P1J23_RS29025 (P1J23_29025) 55680..55931 + 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P1J23_RS29030 (P1J23_29030) 55928..56215 + 288 WP_169030134.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J23_RS29035 (P1J23_29035) 56217..56495 + 279 Protein_82 integrase core domain-containing protein -
P1J23_RS29040 (P1J23_29040) 56398..56736 + 339 WP_236448435.1 hypothetical protein -
P1J23_RS29045 (P1J23_29045) 57145..58122 + 978 WP_000361618.1 RepB family plasmid replication initiator protein -
P1J23_RS29050 (P1J23_29050) 58359..59095 - 737 Protein_85 tyrosine-type recombinase/integrase -
P1J23_RS29055 (P1J23_29055) 59269..59706 - 438 WP_169030135.1 type II toxin-antitoxin system HicB family antitoxin -
P1J23_RS29060 (P1J23_29060) 59731..59913 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
P1J23_RS29065 (P1J23_29065) 60188..60700 - 513 Protein_88 integrase core domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyB 1..80662 80662
- inside IScluster/Tn - - 35391..63087 27696


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11185.28 Da        Isoelectric Point: 10.6082

>T274389 WP_169030134.1 NZ_CP119745:55928-56215 [Escherichia coli]
MRYQVKFREDALKEWQKLDKAIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDKQLIIAVVAVGK
RERSDVYNLASEKMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT274389 WP_001132895.1 NZ_CP119745:55680-55931 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References