Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 11387..11934 Replicon plasmid pE94-5
Accession NZ_CP119745
Organism Escherichia coli strain E94

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag P1J23_RS28715 Protein ID WP_244462184.1
Coordinates 11387..11665 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID F4V9S6
Locus tag P1J23_RS28720 Protein ID WP_000079931.1
Coordinates 11665..11934 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J23_RS28670 (P1J23_28670) 6535..7088 - 554 Protein_9 DUF1380 family protein -
P1J23_RS28675 (P1J23_28675) 6982..7203 - 222 WP_001104902.1 hypothetical protein -
P1J23_RS28680 (P1J23_28680) 7204..7887 - 684 WP_169030096.1 DNA methylase -
P1J23_RS28685 (P1J23_28685) 7964..8266 - 303 WP_169030101.1 hypothetical protein -
P1J23_RS28690 (P1J23_28690) 8406..9368 + 963 WP_169030097.1 plasmid segregation protein ParM -
P1J23_RS28695 (P1J23_28695) 9371..9721 + 351 WP_000361389.1 plasmid partitioning/stability family protein -
P1J23_RS28700 (P1J23_28700) 9893..10249 + 357 WP_169030095.1 hypothetical protein -
P1J23_RS28705 (P1J23_28705) 10521..11066 - 546 WP_236448444.1 hypothetical protein -
P1J23_RS28710 (P1J23_28710) 11137..11315 - 179 Protein_17 type II toxin-antitoxin system RelE/ParE family toxin -
P1J23_RS28715 (P1J23_28715) 11387..11665 - 279 WP_244462184.1 type II toxin-antitoxin system toxin YacB Toxin
P1J23_RS28720 (P1J23_28720) 11665..11934 - 270 WP_000079931.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
P1J23_RS28725 (P1J23_28725) 12007..12147 - 141 WP_000829596.1 hypothetical protein -
P1J23_RS28730 (P1J23_28730) 12848..13705 - 858 WP_024236927.1 incFII family plasmid replication initiator RepA -
P1J23_RS28735 (P1J23_28735) 13698..13772 - 75 WP_001375168.1 RepA leader peptide Tap -
P1J23_RS28740 (P1J23_28740) 14009..14263 - 255 WP_000083830.1 replication regulatory protein RepA -
P1J23_RS28745 (P1J23_28745) 14503..15093 - 591 WP_000766807.1 DUF2726 domain-containing protein -
P1J23_RS28750 (P1J23_28750) 15131..15340 - 210 WP_001610317.1 hemolysin expression modulator Hha -
P1J23_RS28755 (P1J23_28755) 15386..15847 - 462 WP_001233868.1 thermonuclease family protein -
P1J23_RS28760 (P1J23_28760) 16049..16300 - 252 WP_001372275.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyB 1..80662 80662


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10746.38 Da        Isoelectric Point: 8.0410

>T274388 WP_244462184.1 NZ_CP119745:c11665-11387 [Escherichia coli]
MEVFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSACSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10194.55 Da        Isoelectric Point: 8.8735

>AT274388 WP_000079931.1 NZ_CP119745:c11934-11665 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DLR5

References