Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 36862..37387 | Replicon | plasmid pE94-4 |
Accession | NZ_CP119744 | ||
Organism | Escherichia coli strain E94 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | P1J23_RS28230 | Protein ID | WP_001159871.1 |
Coordinates | 37082..37387 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | P1J23_RS28225 | Protein ID | WP_000813634.1 |
Coordinates | 36862..37080 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J23_RS28205 (P1J23_28205) | 33056..34057 | + | 1002 | WP_000785695.1 | DUF4238 domain-containing protein | - |
P1J23_RS28210 (P1J23_28210) | 34231..34575 | - | 345 | WP_000792769.1 | hypothetical protein | - |
P1J23_RS28215 (P1J23_28215) | 35073..35327 | - | 255 | WP_000678528.1 | hypothetical protein | - |
P1J23_RS28220 (P1J23_28220) | 35377..36303 | - | 927 | WP_001290414.1 | hypothetical protein | - |
P1J23_RS28225 (P1J23_28225) | 36862..37080 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
P1J23_RS28230 (P1J23_28230) | 37082..37387 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
P1J23_RS28235 (P1J23_28235) | 37388..38197 | + | 810 | WP_000016963.1 | site-specific integrase | - |
P1J23_RS28240 (P1J23_28240) | 38369..38563 | + | 195 | Protein_47 | colicin M immunity protein | - |
P1J23_RS28245 (P1J23_28245) | 38619..39316 | + | 698 | WP_223200906.1 | IS1-like element IS1A family transposase | - |
P1J23_RS28250 (P1J23_28250) | 39332..39922 | - | 591 | Protein_49 | colicin-like bacteriocin tRNase domain-containing protein | - |
P1J23_RS28255 (P1J23_28255) | 40102..40528 | + | 427 | Protein_50 | tyrosine-type recombinase/integrase | - |
P1J23_RS28260 (P1J23_28260) | 40720..40995 | - | 276 | WP_000239529.1 | hypothetical protein | - |
P1J23_RS28265 (P1J23_28265) | 40989..41633 | - | 645 | WP_000633913.1 | division plane positioning ATPase MipZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) / mph(A) | - | 1..99623 | 99623 | |
- | flank | IS/Tn | - | - | 31800..32723 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T274387 WP_001159871.1 NZ_CP119744:37082-37387 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3TCJ | |
PDB | 2H3A | |
PDB | 2ADN | |
PDB | 2ADL | |
PDB | 3HPW | |
PDB | 2H3C | |
PDB | 3G7Z | |
AlphaFold DB | A0A829CQY2 |