Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 81060..81607 Replicon plasmid pE94-2
Accession NZ_CP119742
Organism Escherichia coli strain E94

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag P1J23_RS27370 Protein ID WP_001384452.1
Coordinates 81060..81338 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag P1J23_RS27375 Protein ID WP_000079941.1
Coordinates 81338..81607 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J23_RS27345 (77113) 77113..78072 + 960 WP_000921958.1 plasmid segregation protein ParM -
P1J23_RS27350 (78072) 78072..78467 + 396 WP_000445930.1 plasmid partitioning/stability family protein -
P1J23_RS27355 (78609) 78609..79520 - 912 WP_024244186.1 toll/interleukin-1 receptor domain-containing protein -
P1J23_RS27360 (79532) 79532..79636 - 105 Protein_99 hypothetical protein -
P1J23_RS27365 (79609) 79609..80751 - 1143 WP_158649904.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
P1J23_RS27370 (81060) 81060..81338 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
P1J23_RS27375 (81338) 81338..81607 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
P1J23_RS27380 (81874) 81874..83046 + 1173 WP_015056461.1 IS21-like element IS21 family transposase -
P1J23_RS27385 (83046) 83046..83438 + 393 Protein_104 IS21-like element IS21 family helper ATPase IstB -
P1J23_RS27390 (83487) 83487..84832 + 1346 WP_103758504.1 IS3 family transposase -
P1J23_RS27395 (85022) 85022..85240 - 219 WP_001353651.1 heat-stable enterotoxin ST-I group a -
P1J23_RS27400 (85370) 85370..86047 + 678 WP_001339397.1 IS66-like element accessory protein TnpA -
P1J23_RS27405 (86047) 86047..86394 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa 1..101030 101030


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T274385 WP_001384452.1 NZ_CP119742:c81338-81060 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT274385 WP_000079941.1 NZ_CP119742:c81607-81338 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References