Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 14874..15433 Replicon plasmid pE94-2
Accession NZ_CP119742
Organism Escherichia coli strain E94

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag P1J23_RS26960 Protein ID WP_000421257.1
Coordinates 14874..15149 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag P1J23_RS26965 Protein ID WP_001178089.1
Coordinates 15149..15433 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J23_RS26930 (9944) 9944..10207 + 264 WP_000063165.1 hypothetical protein -
P1J23_RS26935 (10379) 10379..10801 + 423 WP_001398192.1 hypothetical protein -
P1J23_RS26940 (11254) 11254..11349 + 96 WP_000609147.1 DinQ-like type I toxin DqlB -
P1J23_RS26945 (12140) 12140..12613 + 474 WP_001122138.1 type II toxin-antitoxin system PemK/MazF family toxin -
P1J23_RS26950 (13036) 13036..13401 + 366 WP_000091308.1 hypothetical protein -
P1J23_RS26955 (13401) 13401..14590 + 1190 Protein_18 IS91 family transposase -
P1J23_RS26960 (14874) 14874..15149 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J23_RS26965 (15149) 15149..15433 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
P1J23_RS26970 (16343) 16343..17200 - 858 WP_122988880.1 incFII family plasmid replication initiator RepA -
P1J23_RS26975 (17193) 17193..17267 - 75 WP_001365705.1 RepA leader peptide Tap -
P1J23_RS26980 (17511) 17511..17759 - 249 WP_000083839.1 replication regulatory protein RepA -
P1J23_RS26985 (18043) 18043..18192 - 150 WP_001378818.1 Hok/Gef family protein -
P1J23_RS26990 (18449) 18449..18913 - 465 WP_000872610.1 hypothetical protein -
P1J23_RS26995 (19068) 19068..19658 - 591 WP_012817838.1 DUF2726 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa 1..101030 101030


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T274384 WP_000421257.1 NZ_CP119742:c15149-14874 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT274384 WP_001178089.1 NZ_CP119742:c15433-15149 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References