Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4615503..4616301 Replicon chromosome
Accession NZ_CP119740
Organism Escherichia coli strain E94

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag P1J23_RS23200 Protein ID WP_000854735.1
Coordinates 4615924..4616301 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag P1J23_RS23195 Protein ID WP_032153712.1
Coordinates 4615503..4615877 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J23_RS23160 (4611236) 4611236..4612120 + 885 WP_024166630.1 50S ribosome-binding GTPase -
P1J23_RS23165 (4612239) 4612239..4612916 + 678 WP_023155728.1 hypothetical protein -
P1J23_RS23170 (4612946) 4612946..4613155 + 210 WP_023155727.1 DUF905 family protein -
P1J23_RS23175 (4613246) 4613246..4614064 + 819 WP_001234693.1 DUF932 domain-containing protein -
P1J23_RS23180 (4614156) 4614156..4614641 + 486 WP_032153711.1 antirestriction protein -
P1J23_RS23185 (4614657) 4614657..4615133 + 477 WP_001186715.1 RadC family protein -
P1J23_RS23190 (4615202) 4615202..4615423 + 222 WP_000692345.1 DUF987 domain-containing protein -
P1J23_RS23195 (4615503) 4615503..4615877 + 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
P1J23_RS23200 (4615924) 4615924..4616301 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
P1J23_RS23205 (4616298) 4616298..4616789 + 492 WP_023155722.1 DUF5983 family protein -
P1J23_RS23210 (4616801) 4616801..4616998 + 198 WP_000839265.1 DUF957 domain-containing protein -
P1J23_RS23215 (4617083) 4617083..4617949 + 867 WP_032153714.1 DUF4942 domain-containing protein -
P1J23_RS23220 (4618021) 4618021..4618284 + 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
P1J23_RS23225 (4618281) 4618281..4618607 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
P1J23_RS23230 (4619071) 4619071..4620333 + 1263 WP_001218820.1 integrase arm-type DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 fimB / fimE / fimA / fimI / fimC / fimD / fimF / fimG / fimH / papG 4529209..4629053 99844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T274379 WP_000854735.1 NZ_CP119740:4615924-4616301 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT274379 WP_032153712.1 NZ_CP119740:4615503-4615877 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References