Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3780282..3780900 | Replicon | chromosome |
| Accession | NZ_CP119740 | ||
| Organism | Escherichia coli strain E94 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | P1J23_RS19030 | Protein ID | WP_001291435.1 |
| Coordinates | 3780682..3780900 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | P1J23_RS19025 | Protein ID | WP_000344800.1 |
| Coordinates | 3780282..3780656 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J23_RS19015 (3775371) | 3775371..3776564 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P1J23_RS19020 (3776587) | 3776587..3779736 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| P1J23_RS19025 (3780282) | 3780282..3780656 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| P1J23_RS19030 (3780682) | 3780682..3780900 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| P1J23_RS19035 (3781072) | 3781072..3781623 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| P1J23_RS19040 (3781739) | 3781739..3782209 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| P1J23_RS19045 (3782373) | 3782373..3783923 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| P1J23_RS19050 (3783965) | 3783965..3784317 | - | 353 | Protein_3732 | DUF1428 family protein | - |
| P1J23_RS19060 (3784696) | 3784696..3785007 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| P1J23_RS19065 (3785038) | 3785038..3785610 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T274378 WP_001291435.1 NZ_CP119740:3780682-3780900 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT274378 WP_000344800.1 NZ_CP119740:3780282-3780656 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |