Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3278725..3279523 | Replicon | chromosome |
Accession | NZ_CP119740 | ||
Organism | Escherichia coli strain E94 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A3L4GA68 |
Locus tag | P1J23_RS16590 | Protein ID | WP_000854898.1 |
Coordinates | 3278725..3279102 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | P1J23_RS16595 | Protein ID | WP_063082308.1 |
Coordinates | 3279149..3279523 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J23_RS16560 (3275386) | 3275386..3276090 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
P1J23_RS16565 (3276375) | 3276375..3276593 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
P1J23_RS16575 (3277084) | 3277084..3277926 | - | 843 | WP_063082311.1 | DUF4942 domain-containing protein | - |
P1J23_RS16580 (3278023) | 3278023..3278220 | - | 198 | WP_063082310.1 | DUF957 domain-containing protein | - |
P1J23_RS16585 (3278240) | 3278240..3278728 | - | 489 | WP_063082309.1 | DUF5983 family protein | - |
P1J23_RS16590 (3278725) | 3278725..3279102 | - | 378 | WP_000854898.1 | TA system toxin CbtA family protein | Toxin |
P1J23_RS16595 (3279149) | 3279149..3279523 | - | 375 | WP_063082308.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P1J23_RS16600 (3279603) | 3279603..3279824 | - | 222 | WP_000692352.1 | DUF987 domain-containing protein | - |
P1J23_RS16605 (3279911) | 3279911..3280387 | - | 477 | WP_001186768.1 | RadC family protein | - |
P1J23_RS16610 (3280403) | 3280403..3280888 | - | 486 | WP_032180519.1 | antirestriction protein | - |
P1J23_RS16615 (3280980) | 3280980..3281798 | - | 819 | WP_001234635.1 | DUF932 domain-containing protein | - |
P1J23_RS16620 (3281892) | 3281892..3282070 | + | 179 | Protein_3262 | hypothetical protein | - |
P1J23_RS16625 (3282209) | 3282209..3282622 | - | 414 | WP_000789536.1 | hypothetical protein | - |
P1J23_RS16630 (3282892) | 3282892..3283431 | - | 540 | WP_001104026.1 | DUF4339 domain-containing protein | - |
P1J23_RS16635 (3283557) | 3283557..3284015 | - | 459 | WP_063082307.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14050.07 Da Isoelectric Point: 8.5190
>T274377 WP_000854898.1 NZ_CP119740:c3279102-3278725 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWKTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWKTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13665.49 Da Isoelectric Point: 6.4653
>AT274377 WP_063082308.1 NZ_CP119740:c3279523-3279149 [Escherichia coli]
VSDTLPRTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTATLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDTLPRTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTATLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|