Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1976542..1977310 Replicon chromosome
Accession NZ_CP119740
Organism Escherichia coli strain E94

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag P1J23_RS09780 Protein ID WP_000854814.1
Coordinates 1976542..1976916 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3W4SUB1
Locus tag P1J23_RS09785 Protein ID WP_044863316.1
Coordinates 1977005..1977310 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J23_RS09740 (1971938) 1971938..1973104 + 1167 WP_001464461.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
P1J23_RS09745 (1973223) 1973223..1973696 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
P1J23_RS09750 (1973894) 1973894..1974952 + 1059 WP_001200891.1 FUSC family protein -
P1J23_RS09755 (1975124) 1975124..1975453 + 330 WP_000450409.1 DUF496 family protein -
P1J23_RS09760 (1975554) 1975554..1975688 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
P1J23_RS09765 (1975808) 1975808..1975936 + 129 Protein_1911 transposase domain-containing protein -
P1J23_RS09770 (1976225) 1976225..1976305 - 81 Protein_1912 hypothetical protein -
P1J23_RS09775 (1976351) 1976351..1976545 - 195 WP_000988600.1 DUF5983 family protein -
P1J23_RS09780 (1976542) 1976542..1976916 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P1J23_RS09785 (1977005) 1977005..1977310 - 306 WP_044863316.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P1J23_RS09790 (1977447) 1977447..1977668 - 222 WP_000692323.1 DUF987 domain-containing protein -
P1J23_RS09795 (1977731) 1977731..1978207 - 477 WP_001186726.1 RadC family protein -
P1J23_RS09800 (1978223) 1978223..1978702 - 480 WP_000860087.1 antirestriction protein -
P1J23_RS09805 (1978784) 1978784..1979602 - 819 WP_247779548.1 DUF932 domain-containing protein -
P1J23_RS09810 (1979702) 1979702..1979935 - 234 WP_001119729.1 DUF905 family protein -
P1J23_RS09815 (1980014) 1980014..1980469 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(2-96)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T274370 WP_000854814.1 NZ_CP119740:c1976916-1976542 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11250.00 Da        Isoelectric Point: 7.2621

>AT274370 WP_044863316.1 NZ_CP119740:c1977310-1977005 [Escherichia coli]
MPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKA
DTLSSCGYVYLAVYPTPEMKN

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A3W4SUB1

References