Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1435532..1436157 | Replicon | chromosome |
| Accession | NZ_CP119740 | ||
| Organism | Escherichia coli strain E94 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P1J23_RS07200 | Protein ID | WP_000911330.1 |
| Coordinates | 1435759..1436157 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | P1J23_RS07195 | Protein ID | WP_000450524.1 |
| Coordinates | 1435532..1435759 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J23_RS07170 (1431335) | 1431335..1431805 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| P1J23_RS07175 (1431805) | 1431805..1432377 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| P1J23_RS07180 (1432523) | 1432523..1433401 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| P1J23_RS07185 (1433418) | 1433418..1434452 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| P1J23_RS07190 (1434665) | 1434665..1435378 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| P1J23_RS07195 (1435532) | 1435532..1435759 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| P1J23_RS07200 (1435759) | 1435759..1436157 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P1J23_RS07205 (1436304) | 1436304..1437167 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| P1J23_RS07210 (1437182) | 1437182..1439197 | + | 2016 | WP_276171350.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| P1J23_RS07215 (1439271) | 1439271..1439969 | + | 699 | WP_000679823.1 | esterase | - |
| P1J23_RS07220 (1440079) | 1440079..1440279 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T274368 WP_000911330.1 NZ_CP119740:1435759-1436157 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|