Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1091715..1092298 | Replicon | chromosome |
| Accession | NZ_CP119740 | ||
| Organism | Escherichia coli strain E94 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | P1J23_RS05460 | Protein ID | WP_000254738.1 |
| Coordinates | 1091963..1092298 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | P1J23_RS05455 | Protein ID | WP_000581937.1 |
| Coordinates | 1091715..1091963 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J23_RS05445 (1088054) | 1088054..1089355 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| P1J23_RS05450 (1089403) | 1089403..1091637 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| P1J23_RS05455 (1091715) | 1091715..1091963 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| P1J23_RS05460 (1091963) | 1091963..1092298 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| P1J23_RS05465 (1092369) | 1092369..1093160 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| P1J23_RS05470 (1093388) | 1093388..1095025 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| P1J23_RS05475 (1095113) | 1095113..1096411 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T274366 WP_000254738.1 NZ_CP119740:1091963-1092298 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|