Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 947205..947859 | Replicon | chromosome |
Accession | NZ_CP119740 | ||
Organism | Escherichia coli strain E94 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | P1J23_RS04780 | Protein ID | WP_000244777.1 |
Coordinates | 947452..947859 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P1J23_RS04775 | Protein ID | WP_000354046.1 |
Coordinates | 947205..947471 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J23_RS04740 (942493) | 942493..942864 | + | 372 | WP_244599612.1 | tail fiber assembly protein | - |
P1J23_RS04745 (942872) | 942872..943050 | + | 179 | Protein_932 | helix-turn-helix domain-containing protein | - |
P1J23_RS04750 (943105) | 943105..943236 | + | 132 | Protein_933 | SDR family oxidoreductase | - |
P1J23_RS04755 (943293) | 943293..944726 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
P1J23_RS04760 (944771) | 944771..945082 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
P1J23_RS04765 (945246) | 945246..945905 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
P1J23_RS04770 (945982) | 945982..946962 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
P1J23_RS04775 (947205) | 947205..947471 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P1J23_RS04780 (947452) | 947452..947859 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
P1J23_RS04785 (947899) | 947899..948420 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
P1J23_RS04790 (948532) | 948532..949428 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P1J23_RS04795 (949453) | 949453..950163 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P1J23_RS04800 (950169) | 950169..951902 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 906580..956907 | 50327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T274365 WP_000244777.1 NZ_CP119740:947452-947859 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |