Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 54600..55135 Replicon plasmid pE92-5
Accession NZ_CP119739
Organism Escherichia coli strain E92

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag P1J22_RS28995 Protein ID WP_169030134.1
Coordinates 54600..54887 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag P1J22_RS29000 Protein ID WP_001132895.1
Coordinates 54884..55135 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J22_RS28960 (P1J22_28960) 50115..50627 + 513 Protein_67 integrase core domain-containing protein -
P1J22_RS28965 (P1J22_28965) 50902..51084 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
P1J22_RS28970 (P1J22_28970) 51109..51546 + 438 WP_169030135.1 type II toxin-antitoxin system HicB family antitoxin -
P1J22_RS28975 (P1J22_28975) 51720..52456 + 737 Protein_70 tyrosine-type recombinase/integrase -
P1J22_RS28980 (P1J22_28980) 52693..53670 - 978 WP_000361618.1 RepB family plasmid replication initiator protein -
P1J22_RS28985 (P1J22_28985) 54079..54417 - 339 WP_236448435.1 hypothetical protein -
P1J22_RS28990 (P1J22_28990) 54320..54598 - 279 Protein_73 integrase core domain-containing protein -
P1J22_RS28995 (P1J22_28995) 54600..54887 - 288 WP_169030134.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J22_RS29000 (P1J22_29000) 54884..55135 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P1J22_RS29005 (P1J22_29005) 55581..56789 - 1209 WP_169030147.1 IS91 family transposase -
P1J22_RS29010 (P1J22_29010) 56770..57042 - 273 WP_011310366.1 hypothetical protein -
P1J22_RS29015 (P1J22_29015) 57265..58452 - 1188 WP_000937614.1 IS91-like element IS91 family transposase -
P1J22_RS29020 (P1J22_29020) 58452..58817 - 366 WP_000124098.1 hypothetical protein -
P1J22_RS29025 (P1J22_29025) 58959..59096 + 138 WP_169030146.1 hypothetical protein -
P1J22_RS29030 (P1J22_29030) 59202..59525 - 324 Protein_81 DDE-type integrase/transposase/recombinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyB 1..80658 80658
- inside IScluster/Tn - - 47728..75424 27696


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11185.28 Da        Isoelectric Point: 10.6082

>T274359 WP_169030134.1 NZ_CP119739:c54887-54600 [Escherichia coli]
MRYQVKFREDALKEWQKLDKAIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDKQLIIAVVAVGK
RERSDVYNLASEKMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT274359 WP_001132895.1 NZ_CP119739:c55135-54884 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References