Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 18223..18770 Replicon plasmid pE92-5
Accession NZ_CP119739
Organism Escherichia coli strain E92

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag P1J22_RS28765 Protein ID WP_244462184.1
Coordinates 18492..18770 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID F4V9S6
Locus tag P1J22_RS28760 Protein ID WP_000079931.1
Coordinates 18223..18492 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J22_RS28720 (P1J22_28720) 13857..14108 + 252 WP_001372275.1 hypothetical protein -
P1J22_RS28725 (P1J22_28725) 14310..14771 + 462 WP_001233868.1 thermonuclease family protein -
P1J22_RS28730 (P1J22_28730) 14817..15026 + 210 WP_001610317.1 hemolysin expression modulator Hha -
P1J22_RS28735 (P1J22_28735) 15064..15654 + 591 WP_000766807.1 DUF2726 domain-containing protein -
P1J22_RS28740 (P1J22_28740) 15894..16148 + 255 WP_000083830.1 replication regulatory protein RepA -
P1J22_RS28745 (P1J22_28745) 16385..16459 + 75 WP_001375168.1 RepA leader peptide Tap -
P1J22_RS28750 (P1J22_28750) 16452..17309 + 858 WP_024236927.1 incFII family plasmid replication initiator RepA -
P1J22_RS28755 (P1J22_28755) 18010..18150 + 141 WP_000829596.1 hypothetical protein -
P1J22_RS28760 (P1J22_28760) 18223..18492 + 270 WP_000079931.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
P1J22_RS28765 (P1J22_28765) 18492..18770 + 279 WP_244462184.1 type II toxin-antitoxin system toxin YacB Toxin
P1J22_RS28770 (P1J22_28770) 18842..19020 + 179 Protein_29 type II toxin-antitoxin system RelE/ParE family toxin -
P1J22_RS28775 (P1J22_28775) 19091..19636 + 546 WP_236448444.1 hypothetical protein -
P1J22_RS28780 (P1J22_28780) 19908..20264 - 357 WP_169030095.1 hypothetical protein -
P1J22_RS28785 (P1J22_28785) 20436..20786 - 351 WP_000361389.1 plasmid partitioning/stability family protein -
P1J22_RS28790 (P1J22_28790) 20789..21751 - 963 WP_169030097.1 plasmid segregation protein ParM -
P1J22_RS28795 (P1J22_28795) 21891..22193 + 303 WP_169030101.1 hypothetical protein -
P1J22_RS28800 (P1J22_28800) 22270..22953 + 684 WP_169030096.1 DNA methylase -
P1J22_RS28805 (P1J22_28805) 22954..23175 + 222 WP_001104902.1 hypothetical protein -
P1J22_RS28810 (P1J22_28810) 23069..23622 + 554 Protein_37 DUF1380 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyB 1..80658 80658


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10746.38 Da        Isoelectric Point: 8.0410

>T274358 WP_244462184.1 NZ_CP119739:18492-18770 [Escherichia coli]
MEVFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSACSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10194.55 Da        Isoelectric Point: 8.8735

>AT274358 WP_000079931.1 NZ_CP119739:18223-18492 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DLR5

References