Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 35145..35746 | Replicon | plasmid pE92-3 |
| Accession | NZ_CP119737 | ||
| Organism | Escherichia coli strain E92 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | P1J22_RS27650 | Protein ID | WP_001216045.1 |
| Coordinates | 35145..35525 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | P1J22_RS27655 | Protein ID | WP_001190712.1 |
| Coordinates | 35525..35746 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1J22_RS27625 (P1J22_27625) | 30585..32027 | - | 1443 | WP_001472843.1 | hypothetical protein | - |
| P1J22_RS27630 (P1J22_27630) | 32069..33262 | - | 1194 | WP_000219607.1 | hypothetical protein | - |
| P1J22_RS27635 (P1J22_27635) | 33349..33801 | - | 453 | WP_016236875.1 | hypothetical protein | - |
| P1J22_RS27640 (P1J22_27640) | 33890..34933 | - | 1044 | WP_000648821.1 | DUF968 domain-containing protein | - |
| P1J22_RS27645 (P1J22_27645) | 34961..35140 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| P1J22_RS27650 (P1J22_27650) | 35145..35525 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| P1J22_RS27655 (P1J22_27655) | 35525..35746 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P1J22_RS27660 (P1J22_27660) | 35929..37485 | + | 1557 | WP_147707485.1 | type I restriction-modification system subunit M | - |
| P1J22_RS27665 (P1J22_27665) | 37482..38687 | + | 1206 | WP_001293319.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mcr-1.1 | - | 1..100459 | 100459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T274356 WP_001216045.1 NZ_CP119737:c35525-35145 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |