Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 85093..85640 Replicon plasmid pE92-2
Accession NZ_CP119736
Organism Escherichia coli strain E92

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag P1J22_RS27380 Protein ID WP_001384452.1
Coordinates 85362..85640 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag P1J22_RS27375 Protein ID WP_000079941.1
Coordinates 85093..85362 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J22_RS27345 (80306) 80306..80653 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
P1J22_RS27350 (80653) 80653..81330 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
P1J22_RS27355 (81460) 81460..81678 + 219 WP_001353651.1 heat-stable enterotoxin ST-I group a -
P1J22_RS27365 (83262) 83262..83654 - 393 Protein_101 IS21-like element IS21 family helper ATPase IstB -
P1J22_RS27370 (83654) 83654..84826 - 1173 WP_015056461.1 IS21-like element IS21 family transposase -
P1J22_RS27375 (85093) 85093..85362 + 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
P1J22_RS27380 (85362) 85362..85640 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
P1J22_RS27385 (85949) 85949..87091 + 1143 WP_158649904.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
P1J22_RS27390 (87064) 87064..87168 + 105 Protein_106 hypothetical protein -
P1J22_RS27395 (87204) 87204..88091 + 888 WP_276171322.1 toll/interleukin-1 receptor domain-containing protein -
P1J22_RS27400 (88233) 88233..88628 - 396 WP_000445930.1 plasmid partitioning/stability family protein -
P1J22_RS27405 (88628) 88628..89587 - 960 WP_000921958.1 plasmid segregation protein ParM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa 1..101028 101028
- inside IScluster/Tn - estIa 57726..84826 27100


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T274355 WP_001384452.1 NZ_CP119736:85362-85640 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT274355 WP_000079941.1 NZ_CP119736:85093-85362 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References