Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 50239..50798 Replicon plasmid pE92-2
Accession NZ_CP119736
Organism Escherichia coli strain E92

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag P1J22_RS27155 Protein ID WP_000421257.1
Coordinates 50523..50798 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag P1J22_RS27150 Protein ID WP_001178089.1
Coordinates 50239..50523 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J22_RS27120 (46014) 46014..46604 + 591 WP_012817838.1 DUF2726 domain-containing protein -
P1J22_RS27125 (46759) 46759..47223 + 465 WP_000872610.1 hypothetical protein -
P1J22_RS27130 (47480) 47480..47629 + 150 WP_001378818.1 Hok/Gef family protein -
P1J22_RS27135 (47913) 47913..48161 + 249 WP_000083839.1 replication regulatory protein RepA -
P1J22_RS27140 (48405) 48405..48479 + 75 WP_001365705.1 RepA leader peptide Tap -
P1J22_RS27145 (48472) 48472..49329 + 858 WP_122988880.1 incFII family plasmid replication initiator RepA -
P1J22_RS27150 (50239) 50239..50523 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
P1J22_RS27155 (50523) 50523..50798 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1J22_RS27160 (51082) 51082..52271 - 1190 Protein_60 IS91 family transposase -
P1J22_RS27165 (52271) 52271..52636 - 366 WP_000091308.1 hypothetical protein -
P1J22_RS27170 (53059) 53059..53532 - 474 WP_001122138.1 type II toxin-antitoxin system PemK/MazF family toxin -
P1J22_RS27175 (54323) 54323..54418 - 96 WP_000609147.1 DinQ-like type I toxin DqlB -
P1J22_RS27180 (54871) 54871..55293 - 423 WP_001398192.1 hypothetical protein -
P1J22_RS27185 (55465) 55465..55728 - 264 WP_000063165.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa 1..101028 101028


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T274353 WP_000421257.1 NZ_CP119736:50523-50798 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT274353 WP_001178089.1 NZ_CP119736:50239-50523 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References