Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4634237..4635038 | Replicon | chromosome |
Accession | NZ_CP119734 | ||
Organism | Escherichia coli strain E92 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EBK0 |
Locus tag | P1J22_RS23305 | Protein ID | WP_001094436.1 |
Coordinates | 4634661..4635038 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7MN76 |
Locus tag | P1J22_RS23300 | Protein ID | WP_015953067.1 |
Coordinates | 4634237..4634614 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1J22_RS23265 (4630150) | 4630150..4630830 | + | 681 | WP_032082725.1 | WYL domain-containing protein | - |
P1J22_RS23270 (4630978) | 4630978..4631655 | + | 678 | WP_001097312.1 | hypothetical protein | - |
P1J22_RS23275 (4631661) | 4631661..4631894 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
P1J22_RS23280 (4631984) | 4631984..4632802 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
P1J22_RS23285 (4632893) | 4632893..4633378 | + | 486 | WP_000860054.1 | antirestriction protein | - |
P1J22_RS23290 (4633393) | 4633393..4633868 | + | 476 | Protein_4564 | RadC family protein | - |
P1J22_RS23295 (4633937) | 4633937..4634158 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
P1J22_RS23300 (4634237) | 4634237..4634614 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
P1J22_RS23305 (4634661) | 4634661..4635038 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
P1J22_RS23310 (4635035) | 4635035..4635523 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
P1J22_RS23315 (4635535) | 4635535..4635732 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
P1J22_RS23320 (4635817) | 4635817..4636662 | + | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
P1J22_RS23325 (4636733) | 4636733..4638268 | + | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T274350 WP_001094436.1 NZ_CP119734:4634661-4635038 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT274350 WP_015953067.1 NZ_CP119734:4634237-4634614 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2L1N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3CIS0 |